SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227813598|ref|YP_002813607.1| from Bacillus anthracis str. CDC 684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227813598|ref|YP_002813607.1|
Domain Number 1 Region: 255-788
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 4.45e-194
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000532
Further Details:      
 
Domain Number 2 Region: 789-936
Classification Level Classification E-value
Superfamily ADC-like 6.1e-34
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0021
Further Details:      
 
Domain Number 3 Region: 5-128
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.02e-32
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0021
Further Details:      
 
Domain Number 4 Region: 136-218
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.6e-17
Family Ferredoxin domains from multidomain proteins 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|227813598|ref|YP_002813607.1|
Sequence length 979
Comment molybdopterin oxidoreductase family protein [Bacillus anthracis str. CDC 684]
Sequence
MKNNMVHITIDGKKYTAEPSSTILGVINENGIEHPQICYVPEVDPIQTCDTCIVEVDGKL
MRSCSTVVTEGMNIERNSTRAKEAQTEAMDRLLENHLLYCTVCDNNNGNCKLHNTAELME
IEHQKYPYEPKVDVSEVDMTHPFYRYDPNQCIACGQCVEVCQNLQVNETLSIDWEAERPR
VIWDEGVSINDSSCVSCGQCVTICPCNALMEKTMLGEAGFMTGLKPDILEPMVDLIKEVE
PGYSGIFAVSEVEAAMRDTRTKKTKTVCTFCGVGCSFEVWTKGRKILKVQPSSDAPVNAI
STCVKGKFGWDFVNSKERITKPLIRKNGTFVESTWEEALNVVANKLGSIKEEYGKDAIGF
ISSSKITNEDNYVIQKLARQVFETNNIDNCSRYCQSPATDGLFRTIGMGGDAGTIKDIAQ
SGLVIIVGCNPTEGHPVLATRIKRAHKLHGQKLIVADLRKTEMAERSDVFISPKQGTDQV
WLMAVTKYMIDQGWHDQQFIDENVNFFEDFKESLTEYTLEYAEEVTGISKETLIQMAEMI
RDADGTCILWGMGVTQNTGGSDTSAAISNLLLATGNYRRPGAGAYPLRGHNNVQGACDMG
TLPGWLPGYQHVTNDMERAKFEMAYGVKINSEPGLNNIEMLHAIDEGEMKAMYLVGEDMA
LVDSNANHVHEVLSSLDFFVVQDVFLSKTAQYADVVLPAAPSLEKEGTFTNTERRVQRLY
QVLPTLGDAKPDWWIVQAIANKLGANWNYSHPSEIFAEMASLSPLFSQANYEVLEGWNSF
HWGSFDGTNTPLLFQDGFNFPDKKARFAIADWVRPAEFPAEFDLHINNGRMLEHFHEGNM
TNKSTGIQTKVPGVFVEVSPALAKERGVKTGSLVRLVSPFGALKLRVLVTDRVKANELYL
PMNSTDNETAINFLTGPAVDTRTNTPAYKQTKVRMEVLEVDGENPMPKANPRNKKRHPQS
GIEVHRKWARPGYVHLTDK
Download sequence
Identical sequences Q81YC1
gi|49186372|ref|YP_029624.1| gi|229603890|ref|YP_002867767.1| NP_845899.1.87267 WP_000794675.1.100214 WP_000794675.1.100595 WP_000794675.1.10208 WP_000794675.1.11427 WP_000794675.1.11676 WP_000794675.1.13115 WP_000794675.1.13233 WP_000794675.1.13820 WP_000794675.1.14721 WP_000794675.1.14855 WP_000794675.1.15460 WP_000794675.1.15569 WP_000794675.1.16170 WP_000794675.1.16997 WP_000794675.1.17146 WP_000794675.1.18976 WP_000794675.1.19258 WP_000794675.1.19435 WP_000794675.1.20390 WP_000794675.1.20680 WP_000794675.1.21021 WP_000794675.1.21258 WP_000794675.1.21776 WP_000794675.1.22865 WP_000794675.1.23269 WP_000794675.1.2419 WP_000794675.1.24334 WP_000794675.1.24556 WP_000794675.1.24608 WP_000794675.1.25752 WP_000794675.1.2618 WP_000794675.1.26665 WP_000794675.1.26721 WP_000794675.1.27644 WP_000794675.1.27987 WP_000794675.1.28427 WP_000794675.1.28729 WP_000794675.1.29101 WP_000794675.1.29787 WP_000794675.1.30110 WP_000794675.1.31490 WP_000794675.1.3236 WP_000794675.1.32576 WP_000794675.1.33338 WP_000794675.1.33367 WP_000794675.1.33740 WP_000794675.1.33876 WP_000794675.1.34646 WP_000794675.1.35684 WP_000794675.1.35886 WP_000794675.1.36305 WP_000794675.1.36763 WP_000794675.1.38036 WP_000794675.1.39781 WP_000794675.1.40550 WP_000794675.1.41165 WP_000794675.1.41675 WP_000794675.1.4439 WP_000794675.1.45305 WP_000794675.1.45533 WP_000794675.1.46236 WP_000794675.1.46699 WP_000794675.1.47145 WP_000794675.1.4763 WP_000794675.1.47798 WP_000794675.1.52794 WP_000794675.1.53137 WP_000794675.1.53493 WP_000794675.1.53683 WP_000794675.1.54189 WP_000794675.1.55811 WP_000794675.1.55958 WP_000794675.1.56042 WP_000794675.1.56270 WP_000794675.1.56959 WP_000794675.1.58160 WP_000794675.1.59095 WP_000794675.1.59310 WP_000794675.1.59575 WP_000794675.1.60402 WP_000794675.1.61213 WP_000794675.1.63560 WP_000794675.1.68607 WP_000794675.1.69203 WP_000794675.1.69822 WP_000794675.1.69894 WP_000794675.1.70065 WP_000794675.1.70996 WP_000794675.1.72704 WP_000794675.1.73325 WP_000794675.1.74226 WP_000794675.1.74538 WP_000794675.1.75499 WP_000794675.1.75870 WP_000794675.1.76125 WP_000794675.1.76783 WP_000794675.1.77668 WP_000794675.1.78644 WP_000794675.1.79315 WP_000794675.1.79584 WP_000794675.1.80439 WP_000794675.1.80695 WP_000794675.1.81799 WP_000794675.1.82289 WP_000794675.1.83951 WP_000794675.1.84045 WP_000794675.1.85689 WP_000794675.1.86119 WP_000794675.1.86140 WP_000794675.1.86239 WP_000794675.1.86288 WP_000794675.1.8698 WP_000794675.1.8825 WP_000794675.1.88641 WP_000794675.1.90791 WP_000794675.1.90883 WP_000794675.1.9186 WP_000794675.1.92686 WP_000794675.1.92831 WP_000794675.1.93271 WP_000794675.1.93744 WP_000794675.1.93927 WP_000794675.1.94237 WP_000794675.1.94322 WP_000794675.1.94784 WP_000794675.1.96934 WP_000794675.1.97781 WP_000794675.1.97861 WP_000794675.1.99445 WP_000794675.1.99485 YP_029624.1.16718 gi|227813598|ref|YP_002813607.1| gi|50196953|ref|YP_052641.1| 198094.BA_3631 260799.BAS3367 261594.GBAA3631 568206.BAMEG_1002 592021.BAA_3657 gi|30263522|ref|NP_845899.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]