SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227814350|ref|YP_002814359.1| from Bacillus anthracis str. CDC 684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227814350|ref|YP_002814359.1|
Domain Number 1 Region: 19-109
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.14e-24
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|227814350|ref|YP_002814359.1|
Sequence length 110
Comment putative sarcosine oxidase, alpha subunit [Bacillus anthracis str. CDC 684]
Sequence
MSRITHHPILGSLNNSNHITFQFNGQQYEAYEHETIAAALLANGIRTLRVHEDNGTPRGI
YCNIGHCSECRVTVNNQANVRACLTVVENGMVVDSGKQHPNIVREMVKKR
Download sequence
Identical sequences A0A0B6BCJ1 A0A0K6M086 A0A242VZT0 A0A243AX43 B7JRV5 Q6HHQ3 Q6HXN2
gi|227814350|ref|YP_002814359.1| gi|218903960|ref|YP_002451794.1| gi|49185654|ref|YP_028906.1| 260799.BAS2647 281309.BT9727_2598 405535.BCAH820_2844 568206.BAMEG_1758 gi|49477875|ref|YP_036923.1| WP_000087057.1.100059 WP_000087057.1.100214 WP_000087057.1.100595 WP_000087057.1.10208 WP_000087057.1.11427 WP_000087057.1.11676 WP_000087057.1.13233 WP_000087057.1.13820 WP_000087057.1.14721 WP_000087057.1.14855 WP_000087057.1.14882 WP_000087057.1.15163 WP_000087057.1.15460 WP_000087057.1.15569 WP_000087057.1.16013 WP_000087057.1.16156 WP_000087057.1.16170 WP_000087057.1.16997 WP_000087057.1.17146 WP_000087057.1.18976 WP_000087057.1.19258 WP_000087057.1.19435 WP_000087057.1.19445 WP_000087057.1.20390 WP_000087057.1.20680 WP_000087057.1.21021 WP_000087057.1.21258 WP_000087057.1.21776 WP_000087057.1.22865 WP_000087057.1.23269 WP_000087057.1.23615 WP_000087057.1.2419 WP_000087057.1.24334 WP_000087057.1.24556 WP_000087057.1.24608 WP_000087057.1.25716 WP_000087057.1.25752 WP_000087057.1.2618 WP_000087057.1.26665 WP_000087057.1.26721 WP_000087057.1.27644 WP_000087057.1.27987 WP_000087057.1.28427 WP_000087057.1.28729 WP_000087057.1.29101 WP_000087057.1.29787 WP_000087057.1.29804 WP_000087057.1.30110 WP_000087057.1.30216 WP_000087057.1.31490 WP_000087057.1.3236 WP_000087057.1.32576 WP_000087057.1.33175 WP_000087057.1.33338 WP_000087057.1.33367 WP_000087057.1.33536 WP_000087057.1.33740 WP_000087057.1.33876 WP_000087057.1.34646 WP_000087057.1.35684 WP_000087057.1.35886 WP_000087057.1.36305 WP_000087057.1.36763 WP_000087057.1.38036 WP_000087057.1.39781 WP_000087057.1.40550 WP_000087057.1.41165 WP_000087057.1.41675 WP_000087057.1.42217 WP_000087057.1.43104 WP_000087057.1.4439 WP_000087057.1.45305 WP_000087057.1.45533 WP_000087057.1.45919 WP_000087057.1.46236 WP_000087057.1.46549 WP_000087057.1.46699 WP_000087057.1.47145 WP_000087057.1.4763 WP_000087057.1.47644 WP_000087057.1.47798 WP_000087057.1.51749 WP_000087057.1.52794 WP_000087057.1.53137 WP_000087057.1.53493 WP_000087057.1.53683 WP_000087057.1.53879 WP_000087057.1.54117 WP_000087057.1.54189 WP_000087057.1.55811 WP_000087057.1.55958 WP_000087057.1.55968 WP_000087057.1.56042 WP_000087057.1.56176 WP_000087057.1.56270 WP_000087057.1.56318 WP_000087057.1.56959 WP_000087057.1.58160 WP_000087057.1.59095 WP_000087057.1.59173 WP_000087057.1.59310 WP_000087057.1.59575 WP_000087057.1.60402 WP_000087057.1.61213 WP_000087057.1.63137 WP_000087057.1.63560 WP_000087057.1.64491 WP_000087057.1.67239 WP_000087057.1.68607 WP_000087057.1.69203 WP_000087057.1.69822 WP_000087057.1.69894 WP_000087057.1.70065 WP_000087057.1.7096 WP_000087057.1.70996 WP_000087057.1.72704 WP_000087057.1.73325 WP_000087057.1.74226 WP_000087057.1.74538 WP_000087057.1.7545 WP_000087057.1.75499 WP_000087057.1.75870 WP_000087057.1.76125 WP_000087057.1.76783 WP_000087057.1.77668 WP_000087057.1.77824 WP_000087057.1.78644 WP_000087057.1.79315 WP_000087057.1.79584 WP_000087057.1.80439 WP_000087057.1.80695 WP_000087057.1.81799 WP_000087057.1.82289 WP_000087057.1.83951 WP_000087057.1.84045 WP_000087057.1.85689 WP_000087057.1.85901 WP_000087057.1.86119 WP_000087057.1.86140 WP_000087057.1.86288 WP_000087057.1.8698 WP_000087057.1.8825 WP_000087057.1.88641 WP_000087057.1.90596 WP_000087057.1.90791 WP_000087057.1.90883 WP_000087057.1.9186 WP_000087057.1.92686 WP_000087057.1.92831 WP_000087057.1.93271 WP_000087057.1.93744 WP_000087057.1.93893 WP_000087057.1.93927 WP_000087057.1.94237 WP_000087057.1.94322 WP_000087057.1.94784 WP_000087057.1.95308 WP_000087057.1.96934 WP_000087057.1.97781 WP_000087057.1.97861 WP_000087057.1.98216 WP_000087057.1.99445 WP_000087057.1.99485 WP_000087057.1.99994 YP_028906.1.16718 YP_036923.1.62562 gi|386736580|ref|YP_006209761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]