SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225849632|ref|YP_002729866.1| from Persephonella marina EX-H1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225849632|ref|YP_002729866.1|
Domain Number 1 Region: 1-289
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.06e-107
Family Methylenetetrahydrofolate reductase 0.0000000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|225849632|ref|YP_002729866.1|
Sequence length 293
Comment 5,10-methylenetetrahydrofolate reductase [Persephonella marina EX-H1]
Sequence
MKIGEILKHINTSISFEFFPPKTPEGEDQLFRTIKDLEKLNPTFVSVTYGAGGSTRERTI
RVVKRIHEQCNLTVMAHLTCIGHSKKEIYDILKGYKDIGIQNILALRGDIPQGQEESFVF
PPDGCRYANELVSFIREQFGDYFSIGVAAYPEGHPESPSLEKDIYYFKKKVEAGAEFAIT
QMFFDNSYFYRYMDLLSKEGINIPVIPGIMPITNFRQIEKFAVMCGATIPKDLVEKLEKV
ENSPEEVAKIGIDYATEQCEDLLKNGVKGLHFYTLNKSKATVEIYRRIKDLIK
Download sequence
Identical sequences C0QT51
123214.PERMA_0068 gi|225849632|ref|YP_002729866.1| WP_012676291.1.53201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]