SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225849635|ref|YP_002729869.1| from Persephonella marina EX-H1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225849635|ref|YP_002729869.1|
Domain Number 1 Region: 196-384
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.84e-69
Family B3/B4 domain of PheRS, PheT 0.0000155
Further Details:      
 
Domain Number 2 Region: 461-680
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.72e-33
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00041
Further Details:      
 
Domain Number 3 Region: 38-186
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-31
Family Myf domain 0.0031
Further Details:      
 
Domain Number 4 Region: 707-795
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.18e-17
Family Anticodon-binding domain of PheRS 0.0022
Further Details:      
 
Domain Number 5 Region: 397-468
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000751
Family Domains B1 and B5 of PheRS-beta, PheT 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|225849635|ref|YP_002729869.1|
Sequence length 803
Comment phenylalanyl-tRNA synthetase, betsubunit A [Persephonella marina EX-H1]
Sequence
MRVPYSWIKEFIDIDIPAEEVVERLNTTGIEAVCETFGEYIEGIVTVKILSVKKHPERDK
LLVCEATDGHKVYQVVTGADNVKEGSTVILAKEGSVIKGIKITKRNFGSIQSEGMFLSLE
ELGISEKSEGVLILPDDIKPGEDPNRILGLGDEKIIEIEITPNRGDALSVRGLAREIGAI
FGIKRKEVFPVISIAEEIIPEIFVNSERCTRYRGIIIKDVNIRPSPFHIQLKLIKSGMNP
INNVVDITNYILLQEGQPLHAFDLDKIEGAVYVRNAREGEKIVTLDGEEKQLKETDLVIA
DDKKVIAIAGVIGGDNTKVDSNTKNILLEAAVFDSISVRKTAKRLAVSTDSSYRFERGVD
IQNLPNAQDKAVELILKTAGGKAVGEKDIYPDPYRPEKIKLREKTVERILGVSIPKEECS
DLLNRLEIPTEIEEDGTVSQIPSFRAFDLKREIDLVEEVGRLKGFDTFGEKYPRVSVESF
RKSDEYLFELRTRDFLKDNGLDEVVTYTFVGEEIFNILGIPVPVIRIENYLLKTQSVMRD
NLAVSLIGVFQENLRHQIKDLSVFEISSAFFEEYEEIRVGLLLSGRYIKGFNFTRDDQRF
STTDKWNFLKVKGLINSYLRSIGLKDVRYIPSDLPYLNPYESADIYINDQYVGYIGKIHP
EKADRLEIPKETYIAELKLRYVPRDINDSSLKEGYLFTLYKNAEIPVFRELPKYPSVKRD
LAFEVAENLQIDKLINVLNRSSELIDKVELFDIYYISSDRKSVALSVEFRAEDRSLSDEE
VNKEVELVIQKMKEEIPDLKLRQ
Download sequence
Identical sequences C0QT54
123214.PERMA_0071 gi|225849635|ref|YP_002729869.1| WP_012676075.1.53201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]