SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225849871|ref|YP_002730105.1| from Persephonella marina EX-H1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225849871|ref|YP_002730105.1|
Domain Number 1 Region: 4-156
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.4e-21
Family MJ1460-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|225849871|ref|YP_002730105.1|
Sequence length 160
Comment V4R domain protein [Persephonella marina EX-H1]
Sequence
MENVLEQISKVKRDKLGTDIPIVIFRALRHFTSIYASDLLGEKGANILFVNAGRTLGKEL
GKVLYDQDINRYLSNVSDFVKKEKIGIINVAEFSDEKLVIQLDECITCAGMDNIGKRICF
FEVGLVLGIVEYYLGKKLSAFESRCNANGEGVCEVTVILK
Download sequence
Identical sequences C0QTU0
WP_012676909.1.53201 123214.PERMA_0312 gi|225849871|ref|YP_002730105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]