SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225849569|ref|YP_002729803.1| from Persephonella marina EX-H1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225849569|ref|YP_002729803.1|
Domain Number 1 Region: 3-320
Classification Level Classification E-value
Superfamily FMN-binding split barrel 3.92e-120
Family UbiD middle domain-like 0.000000129
Further Details:      
 
Domain Number 2 Region: 321-479
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 7.85e-56
Family UbiD C-terminal domain-like 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225849569|ref|YP_002729803.1|
Sequence length 503
Comment menaquinone biosynthesis decarboxylase, family [Persephonella marina EX-H1]
Sequence
MAYRDLREFIKDLDKNGELIRIKDRVSPVLEITEIADNVMKLPDGGKALLFENVEGSDMP
VLINAFGSEKRMKMALGVERFEDIGWKLYRILKPEVPHTFLDKLKRIPELKKLNDALPKT
VKTGSVKEVIKKGDDIDLFEIPVLKCWPKDGGRFITLPQVISKDPENGLRNVGMYRIQIL
DRDKVAVHWQIHKGGAKHYWKYKKLGQKIPVAIAIGGDPVLTYVASAPLPEDVDEYLFAG
IIRGKGVELVRCETVDLEVPADAEIIIEGYIDPEEPLVDEGPFGDHTGFYTPVEKYPMMH
VTAVTHRKDPVYLTTIVGRPPMEDGWMGKATERIFLPLIKFNLPEVVDYNLPVSGCFHNF
CFVSIKKQYPGHAYKVMDALWGMGQMMFTKNIVVFDEWVDVQSIDDVLWIWGNNVDPARD
VVIKKGVIDVLDHSTDLVGFGGKMGIDATTKWKGEGYQREWPELAVMDESVKERMKPVVN
RVMKEIMKSIIDKEVKKAKKYLK
Download sequence
Identical sequences C0QSY8
WP_012676487.1.53201 gi|225849569|ref|YP_002729803.1| 123214.PERMA_0005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]