SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225849954|ref|YP_002730188.1| from Persephonella marina EX-H1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225849954|ref|YP_002730188.1|
Domain Number 1 Region: 8-232
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.31e-54
Family PP-loop ATPase 0.0000214
Further Details:      
 
Domain Number 2 Region: 371-446
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.54e-20
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0089
Further Details:      
 
Domain Number 3 Region: 211-312
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000000471
Family MesJ substrate recognition domain-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|225849954|ref|YP_002730188.1|
Sequence length 452
Comment tRNA(Ile)-lysidine synthase [Persephonella marina EX-H1]
Sequence
MVEKKFLEAVKKYSLISEGDRILVAFSGGIDSTVLTYLLIKFRDHLKISDIYLAHLNHSL
RKESDEDQRFCEDFAKKYGLEIFTKKVDIKSLAEKEKKSIEQKAREERYSFFRKVMEERS
INRLATGHHLSDLVETMIMWFIQGNRKGIKGFRPKERDIIRPLYLINKDQIENYAREKGI
EYRIDITNFETDFLRNRIRHNIIPHIKGINPSLEGSLLTLSYFLSLDDQYLEEESEKISQ
KFLNGKIELEELLVYDKALVYRAIQNWIYRKTGVYPSYRQIMDIMEIIEKKEGTKSIRLS
PEYNLIRRYSTLYIEKVKEKTEPYQYRIKPGEKIFVKEANLYIKSYIETDYTLDKLKDER
KKVCFQIESMEDAEFVVRNRRKGDRFIPFGRKKEKKLKDVMIDLKIPSDMRENIPLVVYG
NKILWIAGYKRSAYFPVTEKGKKLICFELEEV
Download sequence
Identical sequences C0QU23
gi|225849954|ref|YP_002730188.1| 123214.PERMA_0397 WP_012676683.1.53201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]