SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227080503|ref|YP_002809054.1| from Vibrio cholerae M66-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227080503|ref|YP_002809054.1|
Domain Number 1 Region: 64-319
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.28e-58
Family L-arabinose binding protein-like 0.0000289
Further Details:      
 
Domain Number 2 Region: 6-64
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000235
Family GalR/LacI-like bacterial regulator 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|227080503|ref|YP_002809054.1|
Sequence length 332
Comment gluconate utilization system gnt-I transcriptional repressor [Vibrio cholerae M66-2]
Sequence
MTKKQRATLQDVADQVGVTKMTVSRYLRSPDSVAAATREKIALAVEALGYIENRAPAMLS
KSSSKAIGILLPSLSNQIFASFVQGIEAVTKANGYETLLAHFGYDEEEEERKIASLLAYQ
VDGLILTESHHTQRTLQMIASSGVPVVETMELPANPIDMAVGMDHVEASYQAVKKIIAAG
KRSIAYFGARLDTRTKLRMQGYDQAMQEAGLPIKHVLTGSHSSFSLAAQLLDEAFARYPD
LDGVFCTNDDIAIGTLLVAQQRGIRVPEQLSVIGYNALDIGRTITPKLTSVDSPRYAIGE
KSAELLIAALKGERAEEHIVDMGYRFTAGESV
Download sequence
Identical sequences A0A0H3AK54 A0A0K9UMT7 A0A2J9SUB4 C3LQP5
WP_000163079.1.101117 WP_000163079.1.10887 WP_000163079.1.14179 WP_000163079.1.14353 WP_000163079.1.15134 WP_000163079.1.15516 WP_000163079.1.18484 WP_000163079.1.19428 WP_000163079.1.2316 WP_000163079.1.23532 WP_000163079.1.24345 WP_000163079.1.2496 WP_000163079.1.25649 WP_000163079.1.26223 WP_000163079.1.28508 WP_000163079.1.30292 WP_000163079.1.31096 WP_000163079.1.34261 WP_000163079.1.34643 WP_000163079.1.35880 WP_000163079.1.36322 WP_000163079.1.36354 WP_000163079.1.36441 WP_000163079.1.36874 WP_000163079.1.37260 WP_000163079.1.37784 WP_000163079.1.40782 WP_000163079.1.4284 WP_000163079.1.45372 WP_000163079.1.46540 WP_000163079.1.4701 WP_000163079.1.47736 WP_000163079.1.47794 WP_000163079.1.52676 WP_000163079.1.53085 WP_000163079.1.5425 WP_000163079.1.56807 WP_000163079.1.60633 WP_000163079.1.61624 WP_000163079.1.64201 WP_000163079.1.65528 WP_000163079.1.68863 WP_000163079.1.70775 WP_000163079.1.74503 WP_000163079.1.78428 WP_000163079.1.80024 WP_000163079.1.80500 WP_000163079.1.80618 WP_000163079.1.85086 WP_000163079.1.86057 WP_000163079.1.86874 WP_000163079.1.89719 WP_000163079.1.90120 WP_000163079.1.90774 WP_000163079.1.90889 WP_000163079.1.96693 WP_000163079.1.97100 WP_000163079.1.99949 gi|147675184|ref|YP_001218545.1| gi|227080503|ref|YP_002809054.1| gi|147675184|ref|YP_001218545.1| 345073.VC0395_A2667 579112.VCM66_0274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]