SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227081458|ref|YP_002810009.1| from Vibrio cholerae M66-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227081458|ref|YP_002810009.1|
Domain Number 1 Region: 61-314
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.5e-66
Family L-arabinose binding protein-like 0.0000921
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.58e-17
Family GalR/LacI-like bacterial regulator 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|227081458|ref|YP_002810009.1|
Sequence length 340
Comment LacI family transcriptional regulator [Vibrio cholerae M66-2]
Sequence
MARIKDVAELAGVNRSTVSRIINGEGKFKEETRRKVEQAMAQLNYRPSAIARSLATSSSN
MMGLLVTYYTGGFFGEMMEQVQTELDMHHKFLITAQGHHSAQGEREAIQRFHDLRCDGYV
LHSRYLSDDDLRALAQQPTPFVLLDRYVAGLEERCITFDHRGASQIVVEYLIQQGHRKIA
CITGPLHRHNSRLRQQGYLDALAQAGILPSKSLCEEGNYGRKSGYFAMQQLFARHPEITA
VFSCSEEMTTGALQYLHEQGIAVPGRISIVSFDSVDLCESLYPTVTAVHFPISEMARAAV
QSLIAMVKQQPTVGPQSFRPILKKRHADQPLSKIAERQDS
Download sequence
Identical sequences A0A0H3PYH9 A0A0H5YRR1 A0A0K9UYK7 A0A0X1KW85 C3LLY2 Q9KSH0
gi|15641299|ref|NP_230931.1| 243277.VC1286 579112.VCM66_1241 593588.VCD_003064 gi|229608146|ref|YP_002878794.1| gi|379741096|ref|YP_005333065.1| gi|360035185|ref|YP_004936948.1| NP_230931.1.72393 WP_000101064.1.100264 WP_000101064.1.100388 WP_000101064.1.100440 WP_000101064.1.10071 WP_000101064.1.100976 WP_000101064.1.101117 WP_000101064.1.10121 WP_000101064.1.101220 WP_000101064.1.101314 WP_000101064.1.101507 WP_000101064.1.101933 WP_000101064.1.102054 WP_000101064.1.1024 WP_000101064.1.10626 WP_000101064.1.10834 WP_000101064.1.10887 WP_000101064.1.11270 WP_000101064.1.11351 WP_000101064.1.11879 WP_000101064.1.11885 WP_000101064.1.11965 WP_000101064.1.12262 WP_000101064.1.12332 WP_000101064.1.12525 WP_000101064.1.12527 WP_000101064.1.12548 WP_000101064.1.12590 WP_000101064.1.12686 WP_000101064.1.13053 WP_000101064.1.13155 WP_000101064.1.13156 WP_000101064.1.13454 WP_000101064.1.13652 WP_000101064.1.13725 WP_000101064.1.14080 WP_000101064.1.14257 WP_000101064.1.14263 WP_000101064.1.14904 WP_000101064.1.14995 WP_000101064.1.15109 WP_000101064.1.15179 WP_000101064.1.15200 WP_000101064.1.15516 WP_000101064.1.15786 WP_000101064.1.15997 WP_000101064.1.16351 WP_000101064.1.16382 WP_000101064.1.17232 WP_000101064.1.17295 WP_000101064.1.17621 WP_000101064.1.18375 WP_000101064.1.18392 WP_000101064.1.18447 WP_000101064.1.18577 WP_000101064.1.18862 WP_000101064.1.18916 WP_000101064.1.19126 WP_000101064.1.19128 WP_000101064.1.19442 WP_000101064.1.19503 WP_000101064.1.19597 WP_000101064.1.20065 WP_000101064.1.20107 WP_000101064.1.20379 WP_000101064.1.20404 WP_000101064.1.20602 WP_000101064.1.20669 WP_000101064.1.20699 WP_000101064.1.20758 WP_000101064.1.21073 WP_000101064.1.21281 WP_000101064.1.21558 WP_000101064.1.21671 WP_000101064.1.21717 WP_000101064.1.21764 WP_000101064.1.21815 WP_000101064.1.21866 WP_000101064.1.22521 WP_000101064.1.22773 WP_000101064.1.229 WP_000101064.1.22953 WP_000101064.1.2304 WP_000101064.1.23333 WP_000101064.1.2341 WP_000101064.1.23416 WP_000101064.1.23424 WP_000101064.1.23538 WP_000101064.1.2354 WP_000101064.1.23808 WP_000101064.1.23955 WP_000101064.1.240 WP_000101064.1.2401 WP_000101064.1.24106 WP_000101064.1.24280 WP_000101064.1.24345 WP_000101064.1.24399 WP_000101064.1.24980 WP_000101064.1.26020 WP_000101064.1.26156 WP_000101064.1.2627 WP_000101064.1.26326 WP_000101064.1.26508 WP_000101064.1.26580 WP_000101064.1.27186 WP_000101064.1.27435 WP_000101064.1.27458 WP_000101064.1.27639 WP_000101064.1.27822 WP_000101064.1.27863 WP_000101064.1.28431 WP_000101064.1.29095 WP_000101064.1.29708 WP_000101064.1.29889 WP_000101064.1.30107 WP_000101064.1.3032 WP_000101064.1.30360 WP_000101064.1.3054 WP_000101064.1.30927 WP_000101064.1.31096 WP_000101064.1.31718 WP_000101064.1.32271 WP_000101064.1.32814 WP_000101064.1.32955 WP_000101064.1.33019 WP_000101064.1.33093 WP_000101064.1.33625 WP_000101064.1.33811 WP_000101064.1.33819 WP_000101064.1.34108 WP_000101064.1.34195 WP_000101064.1.34634 WP_000101064.1.34643 WP_000101064.1.3514 WP_000101064.1.35201 WP_000101064.1.35266 WP_000101064.1.35630 WP_000101064.1.35880 WP_000101064.1.35881 WP_000101064.1.3635 WP_000101064.1.36354 WP_000101064.1.36441 WP_000101064.1.36513 WP_000101064.1.36668 WP_000101064.1.36686 WP_000101064.1.36874 WP_000101064.1.36973 WP_000101064.1.37054 WP_000101064.1.37260 WP_000101064.1.37262 WP_000101064.1.37676 WP_000101064.1.37784 WP_000101064.1.37999 WP_000101064.1.38420 WP_000101064.1.38590 WP_000101064.1.39514 WP_000101064.1.39675 WP_000101064.1.39853 WP_000101064.1.39933 WP_000101064.1.40039 WP_000101064.1.40152 WP_000101064.1.40433 WP_000101064.1.40459 WP_000101064.1.40470 WP_000101064.1.40484 WP_000101064.1.40491 WP_000101064.1.40542 WP_000101064.1.40740 WP_000101064.1.41573 WP_000101064.1.4175 WP_000101064.1.42128 WP_000101064.1.42152 WP_000101064.1.42498 WP_000101064.1.42617 WP_000101064.1.4272 WP_000101064.1.4284 WP_000101064.1.42853 WP_000101064.1.42865 WP_000101064.1.42885 WP_000101064.1.43335 WP_000101064.1.4365 WP_000101064.1.43884 WP_000101064.1.439 WP_000101064.1.44569 WP_000101064.1.44709 WP_000101064.1.44730 WP_000101064.1.45055 WP_000101064.1.45127 WP_000101064.1.45155 WP_000101064.1.45206 WP_000101064.1.45264 WP_000101064.1.45372 WP_000101064.1.45704 WP_000101064.1.45842 WP_000101064.1.45903 WP_000101064.1.45958 WP_000101064.1.46118 WP_000101064.1.46146 WP_000101064.1.4661 WP_000101064.1.47202 WP_000101064.1.4730 WP_000101064.1.4731 WP_000101064.1.47417 WP_000101064.1.47428 WP_000101064.1.47736 WP_000101064.1.47796 WP_000101064.1.47846 WP_000101064.1.47942 WP_000101064.1.48128 WP_000101064.1.48715 WP_000101064.1.488 WP_000101064.1.48927 WP_000101064.1.49238 WP_000101064.1.49317 WP_000101064.1.50277 WP_000101064.1.50577 WP_000101064.1.50625 WP_000101064.1.50813 WP_000101064.1.50822 WP_000101064.1.50980 WP_000101064.1.51177 WP_000101064.1.51661 WP_000101064.1.5201 WP_000101064.1.52391 WP_000101064.1.5320 WP_000101064.1.53214 WP_000101064.1.5397 WP_000101064.1.54191 WP_000101064.1.5425 WP_000101064.1.54398 WP_000101064.1.5450 WP_000101064.1.54706 WP_000101064.1.54901 WP_000101064.1.55092 WP_000101064.1.55665 WP_000101064.1.55929 WP_000101064.1.55932 WP_000101064.1.56429 WP_000101064.1.56785 WP_000101064.1.57148 WP_000101064.1.57300 WP_000101064.1.57518 WP_000101064.1.57546 WP_000101064.1.57678 WP_000101064.1.57945 WP_000101064.1.58295 WP_000101064.1.58596 WP_000101064.1.58844 WP_000101064.1.58975 WP_000101064.1.59010 WP_000101064.1.59194 WP_000101064.1.59378 WP_000101064.1.59394 WP_000101064.1.5943 WP_000101064.1.59554 WP_000101064.1.59633 WP_000101064.1.59741 WP_000101064.1.59916 WP_000101064.1.60386 WP_000101064.1.60633 WP_000101064.1.60694 WP_000101064.1.60955 WP_000101064.1.61169 WP_000101064.1.61523 WP_000101064.1.61644 WP_000101064.1.61753 WP_000101064.1.61869 WP_000101064.1.61875 WP_000101064.1.61935 WP_000101064.1.62165 WP_000101064.1.62324 WP_000101064.1.62425 WP_000101064.1.63347 WP_000101064.1.63546 WP_000101064.1.63655 WP_000101064.1.6366 WP_000101064.1.63723 WP_000101064.1.63749 WP_000101064.1.63779 WP_000101064.1.63911 WP_000101064.1.64201 WP_000101064.1.64253 WP_000101064.1.64315 WP_000101064.1.64382 WP_000101064.1.64441 WP_000101064.1.65007 WP_000101064.1.65051 WP_000101064.1.65086 WP_000101064.1.66329 WP_000101064.1.66633 WP_000101064.1.66696 WP_000101064.1.67616 WP_000101064.1.68424 WP_000101064.1.68506 WP_000101064.1.68723 WP_000101064.1.68925 WP_000101064.1.69049 WP_000101064.1.69843 WP_000101064.1.69857 WP_000101064.1.70069 WP_000101064.1.70176 WP_000101064.1.70247 WP_000101064.1.7049 WP_000101064.1.70813 WP_000101064.1.70892 WP_000101064.1.71129 WP_000101064.1.72106 WP_000101064.1.72241 WP_000101064.1.72326 WP_000101064.1.72361 WP_000101064.1.72369 WP_000101064.1.7238 WP_000101064.1.72480 WP_000101064.1.72856 WP_000101064.1.73148 WP_000101064.1.73429 WP_000101064.1.73555 WP_000101064.1.73855 WP_000101064.1.73929 WP_000101064.1.74111 WP_000101064.1.74503 WP_000101064.1.74666 WP_000101064.1.74991 WP_000101064.1.75012 WP_000101064.1.75326 WP_000101064.1.75778 WP_000101064.1.76425 WP_000101064.1.76486 WP_000101064.1.7654 WP_000101064.1.76645 WP_000101064.1.77029 WP_000101064.1.7717 WP_000101064.1.77355 WP_000101064.1.77397 WP_000101064.1.77445 WP_000101064.1.77703 WP_000101064.1.77794 WP_000101064.1.77830 WP_000101064.1.77914 WP_000101064.1.78157 WP_000101064.1.78531 WP_000101064.1.79044 WP_000101064.1.79776 WP_000101064.1.79943 WP_000101064.1.80024 WP_000101064.1.8023 WP_000101064.1.80339 WP_000101064.1.80500 WP_000101064.1.80618 WP_000101064.1.80628 WP_000101064.1.80744 WP_000101064.1.80808 WP_000101064.1.8117 WP_000101064.1.81871 WP_000101064.1.81917 WP_000101064.1.82119 WP_000101064.1.82193 WP_000101064.1.82248 WP_000101064.1.82262 WP_000101064.1.82413 WP_000101064.1.82583 WP_000101064.1.83040 WP_000101064.1.83073 WP_000101064.1.83082 WP_000101064.1.83109 WP_000101064.1.83703 WP_000101064.1.83761 WP_000101064.1.84385 WP_000101064.1.84519 WP_000101064.1.84610 WP_000101064.1.8480 WP_000101064.1.85007 WP_000101064.1.85086 WP_000101064.1.85498 WP_000101064.1.85822 WP_000101064.1.85878 WP_000101064.1.85961 WP_000101064.1.85972 WP_000101064.1.85998 WP_000101064.1.86057 WP_000101064.1.86192 WP_000101064.1.86269 WP_000101064.1.86874 WP_000101064.1.86879 WP_000101064.1.87274 WP_000101064.1.87335 WP_000101064.1.87355 WP_000101064.1.87573 WP_000101064.1.87602 WP_000101064.1.87804 WP_000101064.1.88057 WP_000101064.1.88230 WP_000101064.1.88283 WP_000101064.1.88350 WP_000101064.1.8867 WP_000101064.1.89441 WP_000101064.1.89447 WP_000101064.1.89822 WP_000101064.1.89889 WP_000101064.1.8997 WP_000101064.1.89995 WP_000101064.1.90133 WP_000101064.1.90227 WP_000101064.1.90437 WP_000101064.1.90675 WP_000101064.1.90774 WP_000101064.1.90889 WP_000101064.1.91247 WP_000101064.1.91262 WP_000101064.1.91274 WP_000101064.1.91539 WP_000101064.1.91747 WP_000101064.1.91794 WP_000101064.1.91841 WP_000101064.1.92038 WP_000101064.1.92063 WP_000101064.1.92069 WP_000101064.1.92157 WP_000101064.1.92401 WP_000101064.1.92516 WP_000101064.1.92559 WP_000101064.1.92696 WP_000101064.1.92703 WP_000101064.1.92952 WP_000101064.1.92993 WP_000101064.1.9302 WP_000101064.1.93060 WP_000101064.1.93399 WP_000101064.1.93836 WP_000101064.1.93945 WP_000101064.1.94255 WP_000101064.1.94426 WP_000101064.1.94441 WP_000101064.1.94481 WP_000101064.1.94887 WP_000101064.1.95516 WP_000101064.1.95549 WP_000101064.1.9561 WP_000101064.1.95662 WP_000101064.1.95733 WP_000101064.1.95976 WP_000101064.1.9607 WP_000101064.1.96089 WP_000101064.1.96187 WP_000101064.1.96311 WP_000101064.1.96471 WP_000101064.1.9660 WP_000101064.1.96687 WP_000101064.1.96704 WP_000101064.1.96980 WP_000101064.1.97100 WP_000101064.1.97144 WP_000101064.1.97516 WP_000101064.1.97552 WP_000101064.1.97650 WP_000101064.1.97799 WP_000101064.1.97832 WP_000101064.1.9787 WP_000101064.1.98021 WP_000101064.1.98116 WP_000101064.1.98172 WP_000101064.1.98246 WP_000101064.1.98280 WP_000101064.1.98624 WP_000101064.1.98642 WP_000101064.1.99128 WP_000101064.1.99204 WP_000101064.1.99417 WP_000101064.1.99452 WP_000101064.1.995 WP_000101064.1.99872 WP_000101064.1.99949 WP_000101064.1.99992 gi|227081458|ref|YP_002810009.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]