SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227081712|ref|YP_002810263.1| from Vibrio cholerae M66-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227081712|ref|YP_002810263.1|
Domain Number 1 Region: 70-340
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.96e-74
Family L-arabinose binding protein-like 0.0000297
Further Details:      
 
Domain Number 2 Region: 10-69
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.09e-18
Family GalR/LacI-like bacterial regulator 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|227081712|ref|YP_002810263.1|
Sequence length 344
Comment LacI family transcriptional regulator [Vibrio cholerae M66-2]
Sequence
MRTQFEGLLMATINDVCKLAGVSKATVSRVLNETGQVKAQTREAVLAAMQQLGYQPNSLA
QALATNTTNSIGLVLPHFESSYFGSILFEAEQGAQKAGKKLLVMNSKNSEQGEKEAVATL
AAQRCDAILLYSRHLNEVQLLELQQQHPSPLVILNRRLHHPQLHSFGLDQTQIAQLAMQH
LLNLGHRQIACITSPLVSETGKIRYQVYQQALHEQGIELSSSLVIEGDNTLLGGYQAMQQ
LLQQGISMTAVFACNDDMALGAMRAMHEHGIHVPKQVSIIGIDNEPAAAFAIPSLSSVSL
PIGELTQQAISLAVEIANKKPQDAQHRLYQGSLIARESTIALKL
Download sequence
Identical sequences A0A0H3ANM6 A0A0H3Q252 A0A0X1KWZ8 A0A1V9PI31 C3LMN6 Q9KRS9
gi|147675752|ref|YP_001217110.1| gi|147675752|ref|YP_001217110.1| NP_231197.1.72393 WP_001881345.1.100264 WP_001881345.1.100388 WP_001881345.1.100440 WP_001881345.1.10071 WP_001881345.1.100976 WP_001881345.1.101117 WP_001881345.1.10121 WP_001881345.1.101220 WP_001881345.1.101314 WP_001881345.1.101507 WP_001881345.1.101933 WP_001881345.1.102054 WP_001881345.1.1024 WP_001881345.1.10626 WP_001881345.1.10834 WP_001881345.1.11270 WP_001881345.1.11351 WP_001881345.1.11879 WP_001881345.1.11885 WP_001881345.1.11965 WP_001881345.1.12252 WP_001881345.1.12262 WP_001881345.1.12332 WP_001881345.1.12525 WP_001881345.1.12527 WP_001881345.1.12548 WP_001881345.1.12590 WP_001881345.1.12686 WP_001881345.1.13053 WP_001881345.1.13155 WP_001881345.1.13156 WP_001881345.1.13454 WP_001881345.1.13652 WP_001881345.1.13725 WP_001881345.1.14080 WP_001881345.1.14179 WP_001881345.1.14257 WP_001881345.1.14263 WP_001881345.1.14904 WP_001881345.1.14995 WP_001881345.1.15109 WP_001881345.1.15134 WP_001881345.1.15179 WP_001881345.1.15200 WP_001881345.1.15516 WP_001881345.1.15786 WP_001881345.1.15997 WP_001881345.1.16351 WP_001881345.1.16382 WP_001881345.1.17232 WP_001881345.1.17295 WP_001881345.1.17621 WP_001881345.1.17738 WP_001881345.1.18375 WP_001881345.1.18392 WP_001881345.1.18447 WP_001881345.1.18577 WP_001881345.1.18862 WP_001881345.1.18916 WP_001881345.1.19126 WP_001881345.1.19128 WP_001881345.1.19428 WP_001881345.1.19442 WP_001881345.1.19503 WP_001881345.1.19597 WP_001881345.1.20107 WP_001881345.1.20379 WP_001881345.1.20404 WP_001881345.1.20602 WP_001881345.1.20669 WP_001881345.1.20699 WP_001881345.1.20758 WP_001881345.1.21073 WP_001881345.1.21281 WP_001881345.1.21558 WP_001881345.1.21671 WP_001881345.1.21717 WP_001881345.1.21764 WP_001881345.1.21815 WP_001881345.1.21866 WP_001881345.1.22521 WP_001881345.1.22773 WP_001881345.1.229 WP_001881345.1.2304 WP_001881345.1.2316 WP_001881345.1.23333 WP_001881345.1.2341 WP_001881345.1.23416 WP_001881345.1.23424 WP_001881345.1.23538 WP_001881345.1.2354 WP_001881345.1.23808 WP_001881345.1.23955 WP_001881345.1.240 WP_001881345.1.2401 WP_001881345.1.24280 WP_001881345.1.24345 WP_001881345.1.24399 WP_001881345.1.24980 WP_001881345.1.25649 WP_001881345.1.26020 WP_001881345.1.26156 WP_001881345.1.26223 WP_001881345.1.2627 WP_001881345.1.26326 WP_001881345.1.26508 WP_001881345.1.26580 WP_001881345.1.27186 WP_001881345.1.27435 WP_001881345.1.27458 WP_001881345.1.27639 WP_001881345.1.27863 WP_001881345.1.28431 WP_001881345.1.2849 WP_001881345.1.28508 WP_001881345.1.29095 WP_001881345.1.29535 WP_001881345.1.29708 WP_001881345.1.29889 WP_001881345.1.30107 WP_001881345.1.3032 WP_001881345.1.30360 WP_001881345.1.3054 WP_001881345.1.30927 WP_001881345.1.31096 WP_001881345.1.31718 WP_001881345.1.32264 WP_001881345.1.32271 WP_001881345.1.32814 WP_001881345.1.32955 WP_001881345.1.33019 WP_001881345.1.33093 WP_001881345.1.33625 WP_001881345.1.33811 WP_001881345.1.33819 WP_001881345.1.34108 WP_001881345.1.34195 WP_001881345.1.34261 WP_001881345.1.34634 WP_001881345.1.34643 WP_001881345.1.3514 WP_001881345.1.35201 WP_001881345.1.35266 WP_001881345.1.35630 WP_001881345.1.35880 WP_001881345.1.35881 WP_001881345.1.36322 WP_001881345.1.3635 WP_001881345.1.36354 WP_001881345.1.36441 WP_001881345.1.36513 WP_001881345.1.36668 WP_001881345.1.36686 WP_001881345.1.36973 WP_001881345.1.37054 WP_001881345.1.37260 WP_001881345.1.37262 WP_001881345.1.37676 WP_001881345.1.37784 WP_001881345.1.37999 WP_001881345.1.38420 WP_001881345.1.38590 WP_001881345.1.39514 WP_001881345.1.39675 WP_001881345.1.39853 WP_001881345.1.39933 WP_001881345.1.40039 WP_001881345.1.40152 WP_001881345.1.40433 WP_001881345.1.40459 WP_001881345.1.40470 WP_001881345.1.40484 WP_001881345.1.40491 WP_001881345.1.40542 WP_001881345.1.40740 WP_001881345.1.40782 WP_001881345.1.41573 WP_001881345.1.4175 WP_001881345.1.42128 WP_001881345.1.42152 WP_001881345.1.42498 WP_001881345.1.42617 WP_001881345.1.4272 WP_001881345.1.4284 WP_001881345.1.42853 WP_001881345.1.42865 WP_001881345.1.42885 WP_001881345.1.43335 WP_001881345.1.4365 WP_001881345.1.43884 WP_001881345.1.439 WP_001881345.1.44569 WP_001881345.1.44709 WP_001881345.1.44730 WP_001881345.1.45055 WP_001881345.1.45127 WP_001881345.1.45155 WP_001881345.1.45206 WP_001881345.1.45264 WP_001881345.1.45372 WP_001881345.1.45704 WP_001881345.1.45842 WP_001881345.1.45958 WP_001881345.1.46118 WP_001881345.1.46146 WP_001881345.1.46540 WP_001881345.1.4661 WP_001881345.1.47202 WP_001881345.1.4730 WP_001881345.1.4731 WP_001881345.1.47417 WP_001881345.1.47428 WP_001881345.1.47794 WP_001881345.1.47796 WP_001881345.1.47846 WP_001881345.1.47942 WP_001881345.1.48128 WP_001881345.1.48715 WP_001881345.1.488 WP_001881345.1.48927 WP_001881345.1.49238 WP_001881345.1.49317 WP_001881345.1.50277 WP_001881345.1.50577 WP_001881345.1.50625 WP_001881345.1.50813 WP_001881345.1.50822 WP_001881345.1.50980 WP_001881345.1.51177 WP_001881345.1.51661 WP_001881345.1.5201 WP_001881345.1.52391 WP_001881345.1.52676 WP_001881345.1.53085 WP_001881345.1.5320 WP_001881345.1.53214 WP_001881345.1.5397 WP_001881345.1.54191 WP_001881345.1.5425 WP_001881345.1.54398 WP_001881345.1.5450 WP_001881345.1.54706 WP_001881345.1.54901 WP_001881345.1.55092 WP_001881345.1.55665 WP_001881345.1.55929 WP_001881345.1.55932 WP_001881345.1.56429 WP_001881345.1.56785 WP_001881345.1.56807 WP_001881345.1.57148 WP_001881345.1.57300 WP_001881345.1.57518 WP_001881345.1.57546 WP_001881345.1.57678 WP_001881345.1.57945 WP_001881345.1.58295 WP_001881345.1.58596 WP_001881345.1.58844 WP_001881345.1.58975 WP_001881345.1.59010 WP_001881345.1.59194 WP_001881345.1.59378 WP_001881345.1.59394 WP_001881345.1.5943 WP_001881345.1.59554 WP_001881345.1.59633 WP_001881345.1.59741 WP_001881345.1.59916 WP_001881345.1.60386 WP_001881345.1.60633 WP_001881345.1.60694 WP_001881345.1.60955 WP_001881345.1.61169 WP_001881345.1.61523 WP_001881345.1.61644 WP_001881345.1.61753 WP_001881345.1.61869 WP_001881345.1.61875 WP_001881345.1.61935 WP_001881345.1.62165 WP_001881345.1.62324 WP_001881345.1.62425 WP_001881345.1.63347 WP_001881345.1.63546 WP_001881345.1.63655 WP_001881345.1.6366 WP_001881345.1.63723 WP_001881345.1.63749 WP_001881345.1.63779 WP_001881345.1.63911 WP_001881345.1.64201 WP_001881345.1.64253 WP_001881345.1.64315 WP_001881345.1.64382 WP_001881345.1.64441 WP_001881345.1.65007 WP_001881345.1.65051 WP_001881345.1.65086 WP_001881345.1.65528 WP_001881345.1.66329 WP_001881345.1.66633 WP_001881345.1.66696 WP_001881345.1.67616 WP_001881345.1.68424 WP_001881345.1.68506 WP_001881345.1.68723 WP_001881345.1.68925 WP_001881345.1.69049 WP_001881345.1.69843 WP_001881345.1.69857 WP_001881345.1.70069 WP_001881345.1.70176 WP_001881345.1.70247 WP_001881345.1.7049 WP_001881345.1.70775 WP_001881345.1.70813 WP_001881345.1.70892 WP_001881345.1.71129 WP_001881345.1.72106 WP_001881345.1.72241 WP_001881345.1.72326 WP_001881345.1.72361 WP_001881345.1.72369 WP_001881345.1.7238 WP_001881345.1.72480 WP_001881345.1.72856 WP_001881345.1.73148 WP_001881345.1.73429 WP_001881345.1.73555 WP_001881345.1.73855 WP_001881345.1.73929 WP_001881345.1.74111 WP_001881345.1.74503 WP_001881345.1.74666 WP_001881345.1.74991 WP_001881345.1.75012 WP_001881345.1.75326 WP_001881345.1.75378 WP_001881345.1.76425 WP_001881345.1.76486 WP_001881345.1.7654 WP_001881345.1.76645 WP_001881345.1.77029 WP_001881345.1.7717 WP_001881345.1.77355 WP_001881345.1.77397 WP_001881345.1.77445 WP_001881345.1.77703 WP_001881345.1.77794 WP_001881345.1.77830 WP_001881345.1.77914 WP_001881345.1.78157 WP_001881345.1.78428 WP_001881345.1.78531 WP_001881345.1.79044 WP_001881345.1.79776 WP_001881345.1.79943 WP_001881345.1.80024 WP_001881345.1.8023 WP_001881345.1.80339 WP_001881345.1.80500 WP_001881345.1.80618 WP_001881345.1.80628 WP_001881345.1.80702 WP_001881345.1.80744 WP_001881345.1.80808 WP_001881345.1.8117 WP_001881345.1.81871 WP_001881345.1.81917 WP_001881345.1.82119 WP_001881345.1.82193 WP_001881345.1.82248 WP_001881345.1.82262 WP_001881345.1.82413 WP_001881345.1.82583 WP_001881345.1.83040 WP_001881345.1.83073 WP_001881345.1.83082 WP_001881345.1.83109 WP_001881345.1.83703 WP_001881345.1.83761 WP_001881345.1.84519 WP_001881345.1.84610 WP_001881345.1.8480 WP_001881345.1.85007 WP_001881345.1.85086 WP_001881345.1.85498 WP_001881345.1.85822 WP_001881345.1.85878 WP_001881345.1.85961 WP_001881345.1.85972 WP_001881345.1.85998 WP_001881345.1.86057 WP_001881345.1.86192 WP_001881345.1.86269 WP_001881345.1.86879 WP_001881345.1.87274 WP_001881345.1.87286 WP_001881345.1.87335 WP_001881345.1.87355 WP_001881345.1.87573 WP_001881345.1.87602 WP_001881345.1.87804 WP_001881345.1.88057 WP_001881345.1.88230 WP_001881345.1.88283 WP_001881345.1.88350 WP_001881345.1.88556 WP_001881345.1.8867 WP_001881345.1.89441 WP_001881345.1.89719 WP_001881345.1.89822 WP_001881345.1.89889 WP_001881345.1.8997 WP_001881345.1.89995 WP_001881345.1.90133 WP_001881345.1.90227 WP_001881345.1.90437 WP_001881345.1.90675 WP_001881345.1.90774 WP_001881345.1.90889 WP_001881345.1.91247 WP_001881345.1.91262 WP_001881345.1.91274 WP_001881345.1.91539 WP_001881345.1.91747 WP_001881345.1.91794 WP_001881345.1.91841 WP_001881345.1.92038 WP_001881345.1.92063 WP_001881345.1.92069 WP_001881345.1.92157 WP_001881345.1.92401 WP_001881345.1.92516 WP_001881345.1.92559 WP_001881345.1.92696 WP_001881345.1.92703 WP_001881345.1.92952 WP_001881345.1.92993 WP_001881345.1.9302 WP_001881345.1.93060 WP_001881345.1.93399 WP_001881345.1.93836 WP_001881345.1.93945 WP_001881345.1.94255 WP_001881345.1.94426 WP_001881345.1.94441 WP_001881345.1.94481 WP_001881345.1.94887 WP_001881345.1.95516 WP_001881345.1.95549 WP_001881345.1.9561 WP_001881345.1.95662 WP_001881345.1.95733 WP_001881345.1.95976 WP_001881345.1.9607 WP_001881345.1.96089 WP_001881345.1.96187 WP_001881345.1.96311 WP_001881345.1.96471 WP_001881345.1.9660 WP_001881345.1.96687 WP_001881345.1.96693 WP_001881345.1.96704 WP_001881345.1.96980 WP_001881345.1.97100 WP_001881345.1.97144 WP_001881345.1.97516 WP_001881345.1.97552 WP_001881345.1.97650 WP_001881345.1.97799 WP_001881345.1.97832 WP_001881345.1.9787 WP_001881345.1.98021 WP_001881345.1.98116 WP_001881345.1.98172 WP_001881345.1.98246 WP_001881345.1.98280 WP_001881345.1.98624 WP_001881345.1.98642 WP_001881345.1.99128 WP_001881345.1.99204 WP_001881345.1.99417 WP_001881345.1.99452 WP_001881345.1.995 WP_001881345.1.99872 WP_001881345.1.99992 gi|227081712|ref|YP_002810263.1| 243277.VC1557 345073.VC0395_A1164 579112.VCM66_1498 593588.VCD_002818 gi|229607902|ref|YP_002878550.1| gi|15641565|ref|NP_231197.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]