SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227081870|ref|YP_002810421.1| from Vibrio cholerae M66-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227081870|ref|YP_002810421.1|
Domain Number 1 Region: 60-332
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.78e-94
Family L-arabinose binding protein-like 0.000000167
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.85e-17
Family GalR/LacI-like bacterial regulator 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|227081870|ref|YP_002810421.1|
Sequence length 336
Comment LacI family transcriptional regulator [Vibrio cholerae M66-2]
Sequence
MATIKDVARLAGVSTTTVSHVINKTRFVAETTQEKVMEAVKQLNYAPSAVARSLKCNTTR
TIGMLVTQSTNLFFSEVIDGVESYCYRQGYTLILCNTGGIYEKQRDYIRMLAEKRVDGIL
VMCSDLTQELQDMLDAHKDIPKVVMDWGPETSHADKIIDNSEEGGYLATKYLTDRGHTEI
ACLSGHFVKAACQERIQGFRRAMAEAKLTVNEDWILEGNFECDTAVLAADKIIAMDKRPT
AVFCFNDTMALGLMSRLQQKGIRIPEDMSVIGYDNIELAEYFSPPLTTVHQPKRRVGKNA
FEILLERIKDKEHERRIFEMHPEIVERDTVKDLTKS
Download sequence
Identical sequences A0A0H3Q6P1 A0A0H5Z498 A0A0K9V066 A0A0X1KXG8 A0A2J9UA10 A5F7H0 C2HSN4 C3LN44 D7H9J9 Q9KRC1
gi|147673764|ref|YP_001217268.1| gi|15641725|ref|NP_231357.1| 243277.VC1721 345073.VC0395_A1324 579112.VCM66_1661 593588.VCD_002658 gi|360035613|ref|YP_004937376.1| gi|379741566|ref|YP_005333535.1| gi|229607744|ref|YP_002878392.1| gi|147673764|ref|YP_001217268.1| gi|227081870|ref|YP_002810421.1| NP_231357.1.72393 WP_000201014.1.100264 WP_000201014.1.100388 WP_000201014.1.100440 WP_000201014.1.100659 WP_000201014.1.10071 WP_000201014.1.100976 WP_000201014.1.101051 WP_000201014.1.101117 WP_000201014.1.10121 WP_000201014.1.101220 WP_000201014.1.101314 WP_000201014.1.101507 WP_000201014.1.101677 WP_000201014.1.101933 WP_000201014.1.102054 WP_000201014.1.1024 WP_000201014.1.10453 WP_000201014.1.10626 WP_000201014.1.10834 WP_000201014.1.10874 WP_000201014.1.10887 WP_000201014.1.11270 WP_000201014.1.11351 WP_000201014.1.11879 WP_000201014.1.11885 WP_000201014.1.11965 WP_000201014.1.11987 WP_000201014.1.12252 WP_000201014.1.12262 WP_000201014.1.12332 WP_000201014.1.12486 WP_000201014.1.12525 WP_000201014.1.12527 WP_000201014.1.12548 WP_000201014.1.12590 WP_000201014.1.12686 WP_000201014.1.12902 WP_000201014.1.13053 WP_000201014.1.13155 WP_000201014.1.13156 WP_000201014.1.13395 WP_000201014.1.13454 WP_000201014.1.13652 WP_000201014.1.13725 WP_000201014.1.14080 WP_000201014.1.14179 WP_000201014.1.14257 WP_000201014.1.14263 WP_000201014.1.14353 WP_000201014.1.14553 WP_000201014.1.14904 WP_000201014.1.14995 WP_000201014.1.15109 WP_000201014.1.15134 WP_000201014.1.15179 WP_000201014.1.15200 WP_000201014.1.15516 WP_000201014.1.15786 WP_000201014.1.15997 WP_000201014.1.16057 WP_000201014.1.16115 WP_000201014.1.16351 WP_000201014.1.16382 WP_000201014.1.17232 WP_000201014.1.17295 WP_000201014.1.17621 WP_000201014.1.17738 WP_000201014.1.18375 WP_000201014.1.18392 WP_000201014.1.18447 WP_000201014.1.18484 WP_000201014.1.18577 WP_000201014.1.18845 WP_000201014.1.18862 WP_000201014.1.18916 WP_000201014.1.19126 WP_000201014.1.19128 WP_000201014.1.19428 WP_000201014.1.19442 WP_000201014.1.19503 WP_000201014.1.19597 WP_000201014.1.20065 WP_000201014.1.20107 WP_000201014.1.20336 WP_000201014.1.20379 WP_000201014.1.20404 WP_000201014.1.20595 WP_000201014.1.20602 WP_000201014.1.20669 WP_000201014.1.20699 WP_000201014.1.20758 WP_000201014.1.21073 WP_000201014.1.21279 WP_000201014.1.21281 WP_000201014.1.21558 WP_000201014.1.21671 WP_000201014.1.21717 WP_000201014.1.21764 WP_000201014.1.21815 WP_000201014.1.21866 WP_000201014.1.22521 WP_000201014.1.22770 WP_000201014.1.22773 WP_000201014.1.229 WP_000201014.1.22953 WP_000201014.1.2304 WP_000201014.1.23134 WP_000201014.1.2316 WP_000201014.1.23333 WP_000201014.1.2341 WP_000201014.1.23416 WP_000201014.1.23424 WP_000201014.1.23532 WP_000201014.1.23538 WP_000201014.1.2354 WP_000201014.1.23808 WP_000201014.1.23955 WP_000201014.1.240 WP_000201014.1.2401 WP_000201014.1.24280 WP_000201014.1.24345 WP_000201014.1.24399 WP_000201014.1.2496 WP_000201014.1.24980 WP_000201014.1.25386 WP_000201014.1.25649 WP_000201014.1.26020 WP_000201014.1.26156 WP_000201014.1.26223 WP_000201014.1.2627 WP_000201014.1.26326 WP_000201014.1.26508 WP_000201014.1.26580 WP_000201014.1.26813 WP_000201014.1.27186 WP_000201014.1.27435 WP_000201014.1.27458 WP_000201014.1.27532 WP_000201014.1.27639 WP_000201014.1.27822 WP_000201014.1.27863 WP_000201014.1.28431 WP_000201014.1.2849 WP_000201014.1.28508 WP_000201014.1.29095 WP_000201014.1.29535 WP_000201014.1.29708 WP_000201014.1.29889 WP_000201014.1.30107 WP_000201014.1.30292 WP_000201014.1.3032 WP_000201014.1.30360 WP_000201014.1.3054 WP_000201014.1.30927 WP_000201014.1.31096 WP_000201014.1.31396 WP_000201014.1.31718 WP_000201014.1.31853 WP_000201014.1.32111 WP_000201014.1.32264 WP_000201014.1.32271 WP_000201014.1.32814 WP_000201014.1.32955 WP_000201014.1.33019 WP_000201014.1.33093 WP_000201014.1.33625 WP_000201014.1.33811 WP_000201014.1.33819 WP_000201014.1.34108 WP_000201014.1.34133 WP_000201014.1.34195 WP_000201014.1.34261 WP_000201014.1.34634 WP_000201014.1.34643 WP_000201014.1.34663 WP_000201014.1.3514 WP_000201014.1.35201 WP_000201014.1.35266 WP_000201014.1.35630 WP_000201014.1.35880 WP_000201014.1.35881 WP_000201014.1.36322 WP_000201014.1.3635 WP_000201014.1.36354 WP_000201014.1.36384 WP_000201014.1.36417 WP_000201014.1.36441 WP_000201014.1.36513 WP_000201014.1.36668 WP_000201014.1.36686 WP_000201014.1.36874 WP_000201014.1.36973 WP_000201014.1.37054 WP_000201014.1.37260 WP_000201014.1.37262 WP_000201014.1.37537 WP_000201014.1.37676 WP_000201014.1.37784 WP_000201014.1.37999 WP_000201014.1.38420 WP_000201014.1.38590 WP_000201014.1.39208 WP_000201014.1.39460 WP_000201014.1.39514 WP_000201014.1.39675 WP_000201014.1.39853 WP_000201014.1.39933 WP_000201014.1.40039 WP_000201014.1.40152 WP_000201014.1.40433 WP_000201014.1.40459 WP_000201014.1.40470 WP_000201014.1.40484 WP_000201014.1.40491 WP_000201014.1.40542 WP_000201014.1.40571 WP_000201014.1.40740 WP_000201014.1.40782 WP_000201014.1.41284 WP_000201014.1.41538 WP_000201014.1.41569 WP_000201014.1.41573 WP_000201014.1.4175 WP_000201014.1.42128 WP_000201014.1.42152 WP_000201014.1.42498 WP_000201014.1.42617 WP_000201014.1.4272 WP_000201014.1.42783 WP_000201014.1.4284 WP_000201014.1.42853 WP_000201014.1.42865 WP_000201014.1.42885 WP_000201014.1.43222 WP_000201014.1.43335 WP_000201014.1.43428 WP_000201014.1.4365 WP_000201014.1.43884 WP_000201014.1.439 WP_000201014.1.44569 WP_000201014.1.44709 WP_000201014.1.44730 WP_000201014.1.45055 WP_000201014.1.45127 WP_000201014.1.45155 WP_000201014.1.45206 WP_000201014.1.45264 WP_000201014.1.45372 WP_000201014.1.45704 WP_000201014.1.45842 WP_000201014.1.45903 WP_000201014.1.45958 WP_000201014.1.46118 WP_000201014.1.46146 WP_000201014.1.46486 WP_000201014.1.46540 WP_000201014.1.4661 WP_000201014.1.4701 WP_000201014.1.47202 WP_000201014.1.4730 WP_000201014.1.4731 WP_000201014.1.47417 WP_000201014.1.47428 WP_000201014.1.47736 WP_000201014.1.47794 WP_000201014.1.47796 WP_000201014.1.47846 WP_000201014.1.47942 WP_000201014.1.48128 WP_000201014.1.48289 WP_000201014.1.48305 WP_000201014.1.48715 WP_000201014.1.48742 WP_000201014.1.488 WP_000201014.1.48927 WP_000201014.1.49238 WP_000201014.1.49317 WP_000201014.1.49593 WP_000201014.1.50254 WP_000201014.1.50277 WP_000201014.1.50577 WP_000201014.1.50625 WP_000201014.1.50813 WP_000201014.1.50822 WP_000201014.1.50899 WP_000201014.1.50980 WP_000201014.1.51160 WP_000201014.1.51177 WP_000201014.1.51661 WP_000201014.1.5201 WP_000201014.1.52391 WP_000201014.1.52676 WP_000201014.1.53085 WP_000201014.1.5320 WP_000201014.1.53214 WP_000201014.1.5397 WP_000201014.1.54191 WP_000201014.1.5425 WP_000201014.1.54398 WP_000201014.1.5450 WP_000201014.1.54706 WP_000201014.1.54831 WP_000201014.1.54901 WP_000201014.1.55092 WP_000201014.1.55665 WP_000201014.1.55929 WP_000201014.1.55932 WP_000201014.1.56429 WP_000201014.1.56785 WP_000201014.1.56807 WP_000201014.1.57148 WP_000201014.1.57300 WP_000201014.1.57518 WP_000201014.1.57546 WP_000201014.1.57678 WP_000201014.1.57751 WP_000201014.1.57945 WP_000201014.1.58295 WP_000201014.1.58367 WP_000201014.1.58596 WP_000201014.1.58844 WP_000201014.1.58975 WP_000201014.1.59010 WP_000201014.1.59194 WP_000201014.1.59378 WP_000201014.1.59394 WP_000201014.1.5943 WP_000201014.1.59554 WP_000201014.1.59633 WP_000201014.1.59741 WP_000201014.1.59916 WP_000201014.1.60216 WP_000201014.1.60386 WP_000201014.1.60633 WP_000201014.1.60694 WP_000201014.1.60800 WP_000201014.1.60955 WP_000201014.1.61169 WP_000201014.1.61523 WP_000201014.1.61624 WP_000201014.1.61644 WP_000201014.1.61753 WP_000201014.1.61869 WP_000201014.1.61875 WP_000201014.1.61935 WP_000201014.1.62165 WP_000201014.1.62324 WP_000201014.1.62425 WP_000201014.1.63347 WP_000201014.1.63546 WP_000201014.1.63655 WP_000201014.1.6366 WP_000201014.1.63723 WP_000201014.1.63749 WP_000201014.1.63779 WP_000201014.1.63911 WP_000201014.1.64201 WP_000201014.1.64253 WP_000201014.1.64315 WP_000201014.1.64382 WP_000201014.1.64441 WP_000201014.1.6455 WP_000201014.1.65007 WP_000201014.1.65051 WP_000201014.1.65086 WP_000201014.1.65528 WP_000201014.1.66329 WP_000201014.1.66633 WP_000201014.1.66696 WP_000201014.1.67770 WP_000201014.1.68424 WP_000201014.1.68506 WP_000201014.1.68723 WP_000201014.1.68863 WP_000201014.1.68925 WP_000201014.1.69049 WP_000201014.1.69085 WP_000201014.1.69157 WP_000201014.1.69843 WP_000201014.1.69857 WP_000201014.1.69943 WP_000201014.1.70069 WP_000201014.1.70176 WP_000201014.1.70247 WP_000201014.1.7049 WP_000201014.1.70775 WP_000201014.1.70813 WP_000201014.1.70892 WP_000201014.1.71129 WP_000201014.1.72106 WP_000201014.1.72241 WP_000201014.1.72326 WP_000201014.1.72361 WP_000201014.1.72369 WP_000201014.1.7238 WP_000201014.1.72480 WP_000201014.1.72856 WP_000201014.1.72964 WP_000201014.1.73148 WP_000201014.1.73429 WP_000201014.1.73555 WP_000201014.1.73855 WP_000201014.1.73929 WP_000201014.1.74111 WP_000201014.1.74503 WP_000201014.1.74666 WP_000201014.1.74991 WP_000201014.1.75012 WP_000201014.1.75326 WP_000201014.1.755 WP_000201014.1.75778 WP_000201014.1.75796 WP_000201014.1.76271 WP_000201014.1.76320 WP_000201014.1.76425 WP_000201014.1.76486 WP_000201014.1.7654 WP_000201014.1.76645 WP_000201014.1.77029 WP_000201014.1.7717 WP_000201014.1.77355 WP_000201014.1.77397 WP_000201014.1.77445 WP_000201014.1.77703 WP_000201014.1.77794 WP_000201014.1.77830 WP_000201014.1.77914 WP_000201014.1.78157 WP_000201014.1.78172 WP_000201014.1.78428 WP_000201014.1.78531 WP_000201014.1.78740 WP_000201014.1.79044 WP_000201014.1.79776 WP_000201014.1.79943 WP_000201014.1.80024 WP_000201014.1.8023 WP_000201014.1.80339 WP_000201014.1.80500 WP_000201014.1.80618 WP_000201014.1.80628 WP_000201014.1.80702 WP_000201014.1.80744 WP_000201014.1.80808 WP_000201014.1.8117 WP_000201014.1.81871 WP_000201014.1.81872 WP_000201014.1.81917 WP_000201014.1.82119 WP_000201014.1.82193 WP_000201014.1.82248 WP_000201014.1.82262 WP_000201014.1.82413 WP_000201014.1.82583 WP_000201014.1.83040 WP_000201014.1.83073 WP_000201014.1.83082 WP_000201014.1.83109 WP_000201014.1.83703 WP_000201014.1.83761 WP_000201014.1.84385 WP_000201014.1.84519 WP_000201014.1.84610 WP_000201014.1.8480 WP_000201014.1.85007 WP_000201014.1.85086 WP_000201014.1.85388 WP_000201014.1.85498 WP_000201014.1.85822 WP_000201014.1.85878 WP_000201014.1.85961 WP_000201014.1.85972 WP_000201014.1.85998 WP_000201014.1.86057 WP_000201014.1.86192 WP_000201014.1.86269 WP_000201014.1.86874 WP_000201014.1.86879 WP_000201014.1.87274 WP_000201014.1.87286 WP_000201014.1.87301 WP_000201014.1.87335 WP_000201014.1.87355 WP_000201014.1.87573 WP_000201014.1.87602 WP_000201014.1.87625 WP_000201014.1.87804 WP_000201014.1.88057 WP_000201014.1.88230 WP_000201014.1.88283 WP_000201014.1.88350 WP_000201014.1.88556 WP_000201014.1.8867 WP_000201014.1.89144 WP_000201014.1.89441 WP_000201014.1.89447 WP_000201014.1.89719 WP_000201014.1.89822 WP_000201014.1.89889 WP_000201014.1.8997 WP_000201014.1.89995 WP_000201014.1.90120 WP_000201014.1.90133 WP_000201014.1.90227 WP_000201014.1.9040 WP_000201014.1.90437 WP_000201014.1.90675 WP_000201014.1.90774 WP_000201014.1.90889 WP_000201014.1.91247 WP_000201014.1.91262 WP_000201014.1.91274 WP_000201014.1.91539 WP_000201014.1.91747 WP_000201014.1.91794 WP_000201014.1.91841 WP_000201014.1.92022 WP_000201014.1.92038 WP_000201014.1.92063 WP_000201014.1.92069 WP_000201014.1.92157 WP_000201014.1.92401 WP_000201014.1.92516 WP_000201014.1.92559 WP_000201014.1.92632 WP_000201014.1.92696 WP_000201014.1.92703 WP_000201014.1.92952 WP_000201014.1.92993 WP_000201014.1.9302 WP_000201014.1.93060 WP_000201014.1.93399 WP_000201014.1.93836 WP_000201014.1.93945 WP_000201014.1.94255 WP_000201014.1.94426 WP_000201014.1.94441 WP_000201014.1.94481 WP_000201014.1.94774 WP_000201014.1.94887 WP_000201014.1.95204 WP_000201014.1.95516 WP_000201014.1.95549 WP_000201014.1.9561 WP_000201014.1.95662 WP_000201014.1.95733 WP_000201014.1.95976 WP_000201014.1.96001 WP_000201014.1.9607 WP_000201014.1.96089 WP_000201014.1.96187 WP_000201014.1.96311 WP_000201014.1.96471 WP_000201014.1.9660 WP_000201014.1.96687 WP_000201014.1.96693 WP_000201014.1.96704 WP_000201014.1.96980 WP_000201014.1.97100 WP_000201014.1.97144 WP_000201014.1.97288 WP_000201014.1.97405 WP_000201014.1.97516 WP_000201014.1.97552 WP_000201014.1.97562 WP_000201014.1.97650 WP_000201014.1.97799 WP_000201014.1.97832 WP_000201014.1.9787 WP_000201014.1.98021 WP_000201014.1.98116 WP_000201014.1.98172 WP_000201014.1.98246 WP_000201014.1.98280 WP_000201014.1.98373 WP_000201014.1.98624 WP_000201014.1.98642 WP_000201014.1.99128 WP_000201014.1.99204 WP_000201014.1.9939 WP_000201014.1.99417 WP_000201014.1.99452 WP_000201014.1.995 WP_000201014.1.99861 WP_000201014.1.99872 WP_000201014.1.99949 WP_000201014.1.99992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]