SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227811758|ref|YP_002811768.1| from Vibrio cholerae M66-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227811758|ref|YP_002811768.1|
Domain Number 1 Region: 60-331
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.94e-95
Family L-arabinose binding protein-like 0.000000317
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.04e-17
Family GalR/LacI-like bacterial regulator 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|227811758|ref|YP_002811768.1|
Sequence length 334
Comment ribose operon repressor [Vibrio cholerae M66-2]
Sequence
MATMKDIARLAGVSTSTVSHVINKSRFVSDEIAERVNNAAQQLNYAPSALARSLKMNRTK
TIGMLVTTSTNPFFGEVVKGVERSCYHQGYNLILCNTEGDNQRMKASINTLLQKRVDGLL
LMCSTLEGERLDVFDRYPDIPIVVMDWGPILFASDKIQDNSLQGGYMAAKHLIECGHKEI
GCITGPLIRHQAQMRYEGYKRALAEAGIAINPDWIVESDFECEGGYQAFEKLYQRGKLPS
ALFVSNDMMAMGVIQAASQRGLRVPDDLSLIGYDDVHIAKFMTPALTTIHQPKYRLGKAA
VDTLLYRLENPDTTAQVVQLEPTLVVRNSVRKLG
Download sequence
Identical sequences A0A0H3AEW4 A0A0H3Q6N0 A0A0H7BV73 A0A0K9UV04 A0A0X1L1V3 C3LUF6 Q9KN33
243277.VCA0132 345073.VC0395_0006 579112.VCM66_A0130 593588.VCD_000114 gi|360038135|ref|YP_004939897.1| gi|147671890|ref|YP_001214847.1| NP_232533.1.72393 WP_000224436.1.100264 WP_000224436.1.100388 WP_000224436.1.100440 WP_000224436.1.10071 WP_000224436.1.100976 WP_000224436.1.101117 WP_000224436.1.10121 WP_000224436.1.101220 WP_000224436.1.101314 WP_000224436.1.101507 WP_000224436.1.101933 WP_000224436.1.102054 WP_000224436.1.1024 WP_000224436.1.10626 WP_000224436.1.10874 WP_000224436.1.10887 WP_000224436.1.11270 WP_000224436.1.11351 WP_000224436.1.11879 WP_000224436.1.11885 WP_000224436.1.11965 WP_000224436.1.12252 WP_000224436.1.12262 WP_000224436.1.12332 WP_000224436.1.12525 WP_000224436.1.12527 WP_000224436.1.12548 WP_000224436.1.12590 WP_000224436.1.12686 WP_000224436.1.13053 WP_000224436.1.13155 WP_000224436.1.13156 WP_000224436.1.13454 WP_000224436.1.13652 WP_000224436.1.13725 WP_000224436.1.14080 WP_000224436.1.14179 WP_000224436.1.14257 WP_000224436.1.14263 WP_000224436.1.14904 WP_000224436.1.14995 WP_000224436.1.15109 WP_000224436.1.15179 WP_000224436.1.15200 WP_000224436.1.15516 WP_000224436.1.15786 WP_000224436.1.15997 WP_000224436.1.16351 WP_000224436.1.16382 WP_000224436.1.17232 WP_000224436.1.17295 WP_000224436.1.17621 WP_000224436.1.18375 WP_000224436.1.18392 WP_000224436.1.18447 WP_000224436.1.18577 WP_000224436.1.18862 WP_000224436.1.18916 WP_000224436.1.19126 WP_000224436.1.19128 WP_000224436.1.19428 WP_000224436.1.19442 WP_000224436.1.19503 WP_000224436.1.19597 WP_000224436.1.20065 WP_000224436.1.20107 WP_000224436.1.20379 WP_000224436.1.20404 WP_000224436.1.20602 WP_000224436.1.20669 WP_000224436.1.20699 WP_000224436.1.20758 WP_000224436.1.21073 WP_000224436.1.21281 WP_000224436.1.21558 WP_000224436.1.21671 WP_000224436.1.21717 WP_000224436.1.21764 WP_000224436.1.21815 WP_000224436.1.21866 WP_000224436.1.22521 WP_000224436.1.22773 WP_000224436.1.229 WP_000224436.1.22953 WP_000224436.1.2304 WP_000224436.1.23333 WP_000224436.1.23361 WP_000224436.1.2341 WP_000224436.1.23416 WP_000224436.1.23424 WP_000224436.1.23532 WP_000224436.1.23538 WP_000224436.1.2354 WP_000224436.1.23808 WP_000224436.1.23955 WP_000224436.1.240 WP_000224436.1.2401 WP_000224436.1.24106 WP_000224436.1.24280 WP_000224436.1.24345 WP_000224436.1.24399 WP_000224436.1.24980 WP_000224436.1.25649 WP_000224436.1.26020 WP_000224436.1.26156 WP_000224436.1.26223 WP_000224436.1.2627 WP_000224436.1.26326 WP_000224436.1.26508 WP_000224436.1.26580 WP_000224436.1.27186 WP_000224436.1.27435 WP_000224436.1.27458 WP_000224436.1.27639 WP_000224436.1.27863 WP_000224436.1.28431 WP_000224436.1.28508 WP_000224436.1.29095 WP_000224436.1.29535 WP_000224436.1.29708 WP_000224436.1.29889 WP_000224436.1.30107 WP_000224436.1.30292 WP_000224436.1.3032 WP_000224436.1.30360 WP_000224436.1.3054 WP_000224436.1.30927 WP_000224436.1.31096 WP_000224436.1.31718 WP_000224436.1.31964 WP_000224436.1.32264 WP_000224436.1.32271 WP_000224436.1.32814 WP_000224436.1.32942 WP_000224436.1.32955 WP_000224436.1.33019 WP_000224436.1.33093 WP_000224436.1.33625 WP_000224436.1.33811 WP_000224436.1.33819 WP_000224436.1.34108 WP_000224436.1.34133 WP_000224436.1.34195 WP_000224436.1.34261 WP_000224436.1.34634 WP_000224436.1.3514 WP_000224436.1.35201 WP_000224436.1.35266 WP_000224436.1.35630 WP_000224436.1.35880 WP_000224436.1.35881 WP_000224436.1.3635 WP_000224436.1.36354 WP_000224436.1.36441 WP_000224436.1.36513 WP_000224436.1.36668 WP_000224436.1.36686 WP_000224436.1.36874 WP_000224436.1.36956 WP_000224436.1.37054 WP_000224436.1.37262 WP_000224436.1.37537 WP_000224436.1.37676 WP_000224436.1.37784 WP_000224436.1.37999 WP_000224436.1.38420 WP_000224436.1.38590 WP_000224436.1.39514 WP_000224436.1.39675 WP_000224436.1.39853 WP_000224436.1.39933 WP_000224436.1.40039 WP_000224436.1.40152 WP_000224436.1.40346 WP_000224436.1.40433 WP_000224436.1.40459 WP_000224436.1.40470 WP_000224436.1.40484 WP_000224436.1.40491 WP_000224436.1.40542 WP_000224436.1.40571 WP_000224436.1.40740 WP_000224436.1.40782 WP_000224436.1.41573 WP_000224436.1.4175 WP_000224436.1.42128 WP_000224436.1.42152 WP_000224436.1.42498 WP_000224436.1.42617 WP_000224436.1.4272 WP_000224436.1.42783 WP_000224436.1.4284 WP_000224436.1.42853 WP_000224436.1.42865 WP_000224436.1.43335 WP_000224436.1.43407 WP_000224436.1.4365 WP_000224436.1.43884 WP_000224436.1.439 WP_000224436.1.44569 WP_000224436.1.44709 WP_000224436.1.44730 WP_000224436.1.45055 WP_000224436.1.45127 WP_000224436.1.45155 WP_000224436.1.45206 WP_000224436.1.45264 WP_000224436.1.45372 WP_000224436.1.45704 WP_000224436.1.45842 WP_000224436.1.45958 WP_000224436.1.46118 WP_000224436.1.46146 WP_000224436.1.46540 WP_000224436.1.4661 WP_000224436.1.47202 WP_000224436.1.4730 WP_000224436.1.4731 WP_000224436.1.47417 WP_000224436.1.47736 WP_000224436.1.47794 WP_000224436.1.47796 WP_000224436.1.47846 WP_000224436.1.47942 WP_000224436.1.48128 WP_000224436.1.48305 WP_000224436.1.48659 WP_000224436.1.48715 WP_000224436.1.488 WP_000224436.1.48874 WP_000224436.1.48927 WP_000224436.1.49238 WP_000224436.1.49317 WP_000224436.1.49593 WP_000224436.1.50277 WP_000224436.1.50625 WP_000224436.1.50813 WP_000224436.1.50822 WP_000224436.1.50980 WP_000224436.1.51160 WP_000224436.1.51177 WP_000224436.1.51661 WP_000224436.1.5201 WP_000224436.1.52391 WP_000224436.1.52676 WP_000224436.1.5320 WP_000224436.1.53214 WP_000224436.1.5397 WP_000224436.1.54191 WP_000224436.1.5425 WP_000224436.1.54398 WP_000224436.1.5450 WP_000224436.1.54706 WP_000224436.1.54901 WP_000224436.1.55092 WP_000224436.1.55665 WP_000224436.1.55929 WP_000224436.1.55932 WP_000224436.1.56429 WP_000224436.1.56785 WP_000224436.1.56807 WP_000224436.1.57098 WP_000224436.1.57148 WP_000224436.1.57300 WP_000224436.1.57518 WP_000224436.1.57546 WP_000224436.1.57678 WP_000224436.1.57945 WP_000224436.1.58295 WP_000224436.1.58596 WP_000224436.1.58844 WP_000224436.1.58975 WP_000224436.1.59010 WP_000224436.1.59194 WP_000224436.1.59378 WP_000224436.1.59394 WP_000224436.1.5943 WP_000224436.1.59554 WP_000224436.1.59633 WP_000224436.1.59741 WP_000224436.1.59916 WP_000224436.1.60386 WP_000224436.1.60633 WP_000224436.1.60694 WP_000224436.1.60955 WP_000224436.1.61169 WP_000224436.1.61523 WP_000224436.1.61644 WP_000224436.1.61753 WP_000224436.1.61869 WP_000224436.1.61875 WP_000224436.1.61935 WP_000224436.1.62165 WP_000224436.1.62324 WP_000224436.1.62425 WP_000224436.1.63347 WP_000224436.1.63546 WP_000224436.1.63655 WP_000224436.1.6366 WP_000224436.1.63723 WP_000224436.1.63749 WP_000224436.1.63779 WP_000224436.1.63911 WP_000224436.1.64201 WP_000224436.1.64253 WP_000224436.1.64315 WP_000224436.1.64382 WP_000224436.1.64441 WP_000224436.1.65007 WP_000224436.1.65051 WP_000224436.1.65086 WP_000224436.1.65528 WP_000224436.1.66329 WP_000224436.1.66633 WP_000224436.1.66696 WP_000224436.1.67839 WP_000224436.1.68424 WP_000224436.1.68506 WP_000224436.1.68723 WP_000224436.1.68925 WP_000224436.1.69049 WP_000224436.1.69085 WP_000224436.1.69843 WP_000224436.1.69857 WP_000224436.1.70069 WP_000224436.1.70176 WP_000224436.1.70247 WP_000224436.1.7049 WP_000224436.1.70813 WP_000224436.1.71129 WP_000224436.1.72106 WP_000224436.1.72326 WP_000224436.1.72361 WP_000224436.1.72369 WP_000224436.1.7238 WP_000224436.1.72480 WP_000224436.1.72856 WP_000224436.1.73148 WP_000224436.1.73429 WP_000224436.1.73555 WP_000224436.1.73855 WP_000224436.1.73929 WP_000224436.1.74111 WP_000224436.1.74503 WP_000224436.1.74666 WP_000224436.1.74991 WP_000224436.1.75012 WP_000224436.1.75326 WP_000224436.1.75378 WP_000224436.1.76320 WP_000224436.1.76425 WP_000224436.1.76486 WP_000224436.1.7654 WP_000224436.1.76645 WP_000224436.1.77029 WP_000224436.1.7717 WP_000224436.1.77355 WP_000224436.1.77397 WP_000224436.1.77445 WP_000224436.1.77703 WP_000224436.1.77794 WP_000224436.1.77830 WP_000224436.1.77914 WP_000224436.1.78157 WP_000224436.1.78428 WP_000224436.1.78531 WP_000224436.1.79044 WP_000224436.1.79776 WP_000224436.1.79943 WP_000224436.1.80024 WP_000224436.1.8023 WP_000224436.1.80339 WP_000224436.1.80500 WP_000224436.1.80618 WP_000224436.1.80628 WP_000224436.1.80702 WP_000224436.1.80744 WP_000224436.1.80808 WP_000224436.1.8117 WP_000224436.1.81871 WP_000224436.1.81917 WP_000224436.1.82119 WP_000224436.1.82193 WP_000224436.1.82248 WP_000224436.1.82262 WP_000224436.1.82413 WP_000224436.1.82583 WP_000224436.1.83040 WP_000224436.1.83073 WP_000224436.1.83082 WP_000224436.1.83109 WP_000224436.1.83703 WP_000224436.1.83761 WP_000224436.1.84385 WP_000224436.1.84519 WP_000224436.1.84610 WP_000224436.1.8480 WP_000224436.1.85086 WP_000224436.1.85498 WP_000224436.1.85822 WP_000224436.1.85878 WP_000224436.1.85961 WP_000224436.1.85972 WP_000224436.1.85998 WP_000224436.1.86057 WP_000224436.1.86192 WP_000224436.1.86269 WP_000224436.1.86874 WP_000224436.1.86879 WP_000224436.1.87274 WP_000224436.1.87286 WP_000224436.1.87335 WP_000224436.1.87355 WP_000224436.1.87573 WP_000224436.1.87602 WP_000224436.1.87625 WP_000224436.1.87804 WP_000224436.1.88057 WP_000224436.1.88230 WP_000224436.1.88283 WP_000224436.1.88350 WP_000224436.1.88556 WP_000224436.1.8867 WP_000224436.1.89441 WP_000224436.1.89447 WP_000224436.1.89822 WP_000224436.1.89889 WP_000224436.1.8997 WP_000224436.1.89995 WP_000224436.1.90133 WP_000224436.1.90227 WP_000224436.1.90437 WP_000224436.1.90675 WP_000224436.1.90774 WP_000224436.1.90889 WP_000224436.1.91247 WP_000224436.1.91262 WP_000224436.1.91274 WP_000224436.1.91539 WP_000224436.1.91747 WP_000224436.1.91794 WP_000224436.1.91841 WP_000224436.1.92038 WP_000224436.1.92063 WP_000224436.1.92069 WP_000224436.1.92157 WP_000224436.1.92401 WP_000224436.1.92412 WP_000224436.1.92516 WP_000224436.1.92559 WP_000224436.1.92696 WP_000224436.1.92703 WP_000224436.1.92952 WP_000224436.1.92993 WP_000224436.1.9302 WP_000224436.1.93060 WP_000224436.1.93399 WP_000224436.1.93441 WP_000224436.1.93836 WP_000224436.1.93945 WP_000224436.1.94255 WP_000224436.1.94426 WP_000224436.1.94441 WP_000224436.1.94481 WP_000224436.1.94774 WP_000224436.1.94827 WP_000224436.1.94887 WP_000224436.1.95516 WP_000224436.1.95549 WP_000224436.1.9561 WP_000224436.1.95662 WP_000224436.1.95733 WP_000224436.1.95976 WP_000224436.1.96001 WP_000224436.1.9607 WP_000224436.1.96089 WP_000224436.1.96187 WP_000224436.1.96311 WP_000224436.1.96471 WP_000224436.1.9660 WP_000224436.1.96687 WP_000224436.1.96693 WP_000224436.1.96704 WP_000224436.1.96980 WP_000224436.1.97100 WP_000224436.1.97144 WP_000224436.1.97516 WP_000224436.1.97552 WP_000224436.1.97832 WP_000224436.1.9787 WP_000224436.1.98021 WP_000224436.1.98116 WP_000224436.1.98172 WP_000224436.1.98246 WP_000224436.1.98280 WP_000224436.1.98373 WP_000224436.1.98624 WP_000224436.1.98642 WP_000224436.1.99128 WP_000224436.1.99204 WP_000224436.1.99417 WP_000224436.1.99452 WP_000224436.1.995 WP_000224436.1.99872 WP_000224436.1.99949 WP_000224436.1.99992 gi|227811758|ref|YP_002811768.1| gi|15600903|ref|NP_232533.1| gi|147671890|ref|YP_001214847.1| gi|379743577|ref|YP_005334629.1| gi|229605174|ref|YP_002875878.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]