SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227812088|ref|YP_002812098.1| from Vibrio cholerae M66-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227812088|ref|YP_002812098.1|
Domain Number 1 Region: 61-312
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.28e-38
Family L-arabinose binding protein-like 0.00058
Further Details:      
 
Domain Number 2 Region: 1-58
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000133
Family GalR/LacI-like bacterial regulator 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|227812088|ref|YP_002812098.1|
Sequence length 326
Comment DNA-binding transcriptional regulator FruR [Vibrio cholerae M66-2]
Sequence
MTLDEIAKLAGVSKTTASYVINGKAQKYRISEKTQHKVMAVVEQYNFRPDHAASALRAGN
SRSFGLIIPDLENTSYARLAKLLEQNSRQAGYQILIACSDDDPQIEMAAAEALVSRRIDA
LFVASGIPSASEYYLKLQQSGTPVIAIDRALDDEYFSCVISEDFGAAFELTRSVLTQDVH
SVGLVGALPELNVSREREQGFAMAVKQRGLPTTLGYGEHFNREEGRKVFAKWVANDQLPD
AVVATSYTLLEGILDVLLEQPELMQKVRLATFGDNRLLDFLPIRVNSLPQQFELIADSAL
ALALNASAKRYQTGIELIPRQLKVRT
Download sequence
Identical sequences A0A0F0B292 A0A0H3AGC2 A0A0H3Q3Z8 A0A0K9UQ61 A0A0X1KZV8 A0A2J9TLG8 C2I0B9 C3LVD6 Q9KM69
gi|229605860|ref|YP_002876564.1| 243277.VCA0519 345073.VC0395_0452 579112.VCM66_A0478 593588.VCD_000808 gi|227812088|ref|YP_002812098.1| gi|15601279|ref|NP_232910.1| NP_232910.1.72393 WP_000171125.1.100264 WP_000171125.1.100388 WP_000171125.1.100440 WP_000171125.1.100659 WP_000171125.1.10071 WP_000171125.1.100976 WP_000171125.1.101117 WP_000171125.1.10121 WP_000171125.1.101220 WP_000171125.1.101314 WP_000171125.1.101507 WP_000171125.1.101677 WP_000171125.1.101933 WP_000171125.1.102054 WP_000171125.1.1024 WP_000171125.1.10453 WP_000171125.1.10626 WP_000171125.1.10834 WP_000171125.1.10887 WP_000171125.1.11351 WP_000171125.1.11879 WP_000171125.1.11885 WP_000171125.1.11987 WP_000171125.1.12252 WP_000171125.1.12262 WP_000171125.1.12332 WP_000171125.1.12486 WP_000171125.1.12525 WP_000171125.1.12527 WP_000171125.1.12548 WP_000171125.1.12590 WP_000171125.1.12686 WP_000171125.1.12828 WP_000171125.1.12902 WP_000171125.1.13053 WP_000171125.1.13155 WP_000171125.1.13156 WP_000171125.1.13395 WP_000171125.1.13454 WP_000171125.1.13652 WP_000171125.1.13725 WP_000171125.1.14080 WP_000171125.1.14179 WP_000171125.1.14263 WP_000171125.1.14353 WP_000171125.1.14553 WP_000171125.1.14904 WP_000171125.1.14995 WP_000171125.1.15109 WP_000171125.1.15134 WP_000171125.1.15179 WP_000171125.1.15200 WP_000171125.1.15516 WP_000171125.1.15786 WP_000171125.1.15919 WP_000171125.1.15997 WP_000171125.1.16115 WP_000171125.1.16351 WP_000171125.1.16382 WP_000171125.1.17001 WP_000171125.1.17232 WP_000171125.1.17295 WP_000171125.1.17621 WP_000171125.1.17738 WP_000171125.1.18375 WP_000171125.1.18392 WP_000171125.1.18447 WP_000171125.1.18484 WP_000171125.1.18577 WP_000171125.1.18845 WP_000171125.1.18862 WP_000171125.1.18916 WP_000171125.1.19126 WP_000171125.1.19128 WP_000171125.1.19428 WP_000171125.1.19442 WP_000171125.1.19503 WP_000171125.1.19597 WP_000171125.1.20065 WP_000171125.1.20107 WP_000171125.1.20336 WP_000171125.1.20379 WP_000171125.1.20404 WP_000171125.1.20602 WP_000171125.1.20669 WP_000171125.1.20699 WP_000171125.1.20758 WP_000171125.1.21073 WP_000171125.1.21179 WP_000171125.1.21281 WP_000171125.1.21558 WP_000171125.1.21671 WP_000171125.1.21717 WP_000171125.1.21764 WP_000171125.1.21815 WP_000171125.1.21866 WP_000171125.1.22521 WP_000171125.1.22770 WP_000171125.1.22773 WP_000171125.1.229 WP_000171125.1.22953 WP_000171125.1.2304 WP_000171125.1.2316 WP_000171125.1.23333 WP_000171125.1.2341 WP_000171125.1.23416 WP_000171125.1.23424 WP_000171125.1.23532 WP_000171125.1.23538 WP_000171125.1.2354 WP_000171125.1.23751 WP_000171125.1.23808 WP_000171125.1.23955 WP_000171125.1.240 WP_000171125.1.2401 WP_000171125.1.24106 WP_000171125.1.24280 WP_000171125.1.24345 WP_000171125.1.24399 WP_000171125.1.24980 WP_000171125.1.25386 WP_000171125.1.25649 WP_000171125.1.26020 WP_000171125.1.26156 WP_000171125.1.26223 WP_000171125.1.2627 WP_000171125.1.26326 WP_000171125.1.26508 WP_000171125.1.26580 WP_000171125.1.27186 WP_000171125.1.27435 WP_000171125.1.27458 WP_000171125.1.27532 WP_000171125.1.27639 WP_000171125.1.27863 WP_000171125.1.28431 WP_000171125.1.2849 WP_000171125.1.28508 WP_000171125.1.29095 WP_000171125.1.29535 WP_000171125.1.29708 WP_000171125.1.29889 WP_000171125.1.30107 WP_000171125.1.30292 WP_000171125.1.3032 WP_000171125.1.30360 WP_000171125.1.3054 WP_000171125.1.30927 WP_000171125.1.31096 WP_000171125.1.31396 WP_000171125.1.31718 WP_000171125.1.31853 WP_000171125.1.32111 WP_000171125.1.32264 WP_000171125.1.32271 WP_000171125.1.32395 WP_000171125.1.32814 WP_000171125.1.32955 WP_000171125.1.33019 WP_000171125.1.33093 WP_000171125.1.33625 WP_000171125.1.33811 WP_000171125.1.33819 WP_000171125.1.34108 WP_000171125.1.34195 WP_000171125.1.34261 WP_000171125.1.34634 WP_000171125.1.34643 WP_000171125.1.3514 WP_000171125.1.35201 WP_000171125.1.35266 WP_000171125.1.35630 WP_000171125.1.35880 WP_000171125.1.35881 WP_000171125.1.36322 WP_000171125.1.3635 WP_000171125.1.36354 WP_000171125.1.36364 WP_000171125.1.36384 WP_000171125.1.36441 WP_000171125.1.36513 WP_000171125.1.36668 WP_000171125.1.36686 WP_000171125.1.36874 WP_000171125.1.36973 WP_000171125.1.37054 WP_000171125.1.37260 WP_000171125.1.37262 WP_000171125.1.37537 WP_000171125.1.37676 WP_000171125.1.37784 WP_000171125.1.37999 WP_000171125.1.38420 WP_000171125.1.38590 WP_000171125.1.39208 WP_000171125.1.39460 WP_000171125.1.39514 WP_000171125.1.39675 WP_000171125.1.39853 WP_000171125.1.39933 WP_000171125.1.40039 WP_000171125.1.40152 WP_000171125.1.40346 WP_000171125.1.40433 WP_000171125.1.40459 WP_000171125.1.40470 WP_000171125.1.40484 WP_000171125.1.40491 WP_000171125.1.40542 WP_000171125.1.40740 WP_000171125.1.40782 WP_000171125.1.41538 WP_000171125.1.41569 WP_000171125.1.41573 WP_000171125.1.4175 WP_000171125.1.42128 WP_000171125.1.42152 WP_000171125.1.42441 WP_000171125.1.42498 WP_000171125.1.42617 WP_000171125.1.4272 WP_000171125.1.4284 WP_000171125.1.42853 WP_000171125.1.42885 WP_000171125.1.43103 WP_000171125.1.43222 WP_000171125.1.43335 WP_000171125.1.43428 WP_000171125.1.4365 WP_000171125.1.43884 WP_000171125.1.439 WP_000171125.1.44136 WP_000171125.1.44569 WP_000171125.1.44709 WP_000171125.1.44730 WP_000171125.1.45055 WP_000171125.1.45127 WP_000171125.1.45155 WP_000171125.1.45206 WP_000171125.1.45264 WP_000171125.1.45372 WP_000171125.1.45704 WP_000171125.1.45842 WP_000171125.1.45903 WP_000171125.1.45958 WP_000171125.1.46118 WP_000171125.1.46146 WP_000171125.1.46540 WP_000171125.1.4661 WP_000171125.1.47202 WP_000171125.1.4730 WP_000171125.1.4731 WP_000171125.1.47417 WP_000171125.1.47428 WP_000171125.1.47736 WP_000171125.1.47794 WP_000171125.1.47796 WP_000171125.1.47846 WP_000171125.1.47942 WP_000171125.1.48128 WP_000171125.1.48715 WP_000171125.1.48742 WP_000171125.1.488 WP_000171125.1.48927 WP_000171125.1.48984 WP_000171125.1.49238 WP_000171125.1.49317 WP_000171125.1.50277 WP_000171125.1.5028 WP_000171125.1.50577 WP_000171125.1.50625 WP_000171125.1.50813 WP_000171125.1.50822 WP_000171125.1.50980 WP_000171125.1.51160 WP_000171125.1.51177 WP_000171125.1.51661 WP_000171125.1.5201 WP_000171125.1.52391 WP_000171125.1.52676 WP_000171125.1.53085 WP_000171125.1.5320 WP_000171125.1.53214 WP_000171125.1.5397 WP_000171125.1.54191 WP_000171125.1.5425 WP_000171125.1.54398 WP_000171125.1.5450 WP_000171125.1.54706 WP_000171125.1.54831 WP_000171125.1.54901 WP_000171125.1.55092 WP_000171125.1.55208 WP_000171125.1.55665 WP_000171125.1.55917 WP_000171125.1.55929 WP_000171125.1.55932 WP_000171125.1.56429 WP_000171125.1.56785 WP_000171125.1.56807 WP_000171125.1.57098 WP_000171125.1.57148 WP_000171125.1.57300 WP_000171125.1.57518 WP_000171125.1.57546 WP_000171125.1.57678 WP_000171125.1.57945 WP_000171125.1.58295 WP_000171125.1.58367 WP_000171125.1.58596 WP_000171125.1.58844 WP_000171125.1.58975 WP_000171125.1.59010 WP_000171125.1.59194 WP_000171125.1.59378 WP_000171125.1.59394 WP_000171125.1.5943 WP_000171125.1.59554 WP_000171125.1.59633 WP_000171125.1.59741 WP_000171125.1.59916 WP_000171125.1.60386 WP_000171125.1.60633 WP_000171125.1.60694 WP_000171125.1.60800 WP_000171125.1.60955 WP_000171125.1.61169 WP_000171125.1.61523 WP_000171125.1.61644 WP_000171125.1.61753 WP_000171125.1.61869 WP_000171125.1.61875 WP_000171125.1.61935 WP_000171125.1.62165 WP_000171125.1.62324 WP_000171125.1.62425 WP_000171125.1.63347 WP_000171125.1.63546 WP_000171125.1.63655 WP_000171125.1.6366 WP_000171125.1.63723 WP_000171125.1.63749 WP_000171125.1.63779 WP_000171125.1.63911 WP_000171125.1.64201 WP_000171125.1.64253 WP_000171125.1.64315 WP_000171125.1.64382 WP_000171125.1.64441 WP_000171125.1.65007 WP_000171125.1.65051 WP_000171125.1.65086 WP_000171125.1.65528 WP_000171125.1.66329 WP_000171125.1.66633 WP_000171125.1.66696 WP_000171125.1.67616 WP_000171125.1.68424 WP_000171125.1.68506 WP_000171125.1.68723 WP_000171125.1.68925 WP_000171125.1.69049 WP_000171125.1.69085 WP_000171125.1.69157 WP_000171125.1.69843 WP_000171125.1.69857 WP_000171125.1.69943 WP_000171125.1.70069 WP_000171125.1.70176 WP_000171125.1.70247 WP_000171125.1.7049 WP_000171125.1.70775 WP_000171125.1.70813 WP_000171125.1.70892 WP_000171125.1.71129 WP_000171125.1.71300 WP_000171125.1.72106 WP_000171125.1.72241 WP_000171125.1.72326 WP_000171125.1.72361 WP_000171125.1.72369 WP_000171125.1.7238 WP_000171125.1.72480 WP_000171125.1.72856 WP_000171125.1.72964 WP_000171125.1.73148 WP_000171125.1.73429 WP_000171125.1.73555 WP_000171125.1.73855 WP_000171125.1.73929 WP_000171125.1.74111 WP_000171125.1.74503 WP_000171125.1.74666 WP_000171125.1.74991 WP_000171125.1.75012 WP_000171125.1.75326 WP_000171125.1.75378 WP_000171125.1.75778 WP_000171125.1.76271 WP_000171125.1.76425 WP_000171125.1.76486 WP_000171125.1.7654 WP_000171125.1.76645 WP_000171125.1.77029 WP_000171125.1.7717 WP_000171125.1.77355 WP_000171125.1.77397 WP_000171125.1.77445 WP_000171125.1.77703 WP_000171125.1.77794 WP_000171125.1.77830 WP_000171125.1.77914 WP_000171125.1.78157 WP_000171125.1.78172 WP_000171125.1.78428 WP_000171125.1.78531 WP_000171125.1.79044 WP_000171125.1.79776 WP_000171125.1.79943 WP_000171125.1.80024 WP_000171125.1.8023 WP_000171125.1.80339 WP_000171125.1.80500 WP_000171125.1.80618 WP_000171125.1.80628 WP_000171125.1.80702 WP_000171125.1.80744 WP_000171125.1.80808 WP_000171125.1.8117 WP_000171125.1.81563 WP_000171125.1.81871 WP_000171125.1.81872 WP_000171125.1.81917 WP_000171125.1.82119 WP_000171125.1.82193 WP_000171125.1.82248 WP_000171125.1.82262 WP_000171125.1.82413 WP_000171125.1.82583 WP_000171125.1.83040 WP_000171125.1.83073 WP_000171125.1.83082 WP_000171125.1.83109 WP_000171125.1.83703 WP_000171125.1.83761 WP_000171125.1.84385 WP_000171125.1.84519 WP_000171125.1.84610 WP_000171125.1.8480 WP_000171125.1.85007 WP_000171125.1.85086 WP_000171125.1.85498 WP_000171125.1.85822 WP_000171125.1.85878 WP_000171125.1.85961 WP_000171125.1.85972 WP_000171125.1.85998 WP_000171125.1.86057 WP_000171125.1.86192 WP_000171125.1.86269 WP_000171125.1.86874 WP_000171125.1.86879 WP_000171125.1.87274 WP_000171125.1.87286 WP_000171125.1.87301 WP_000171125.1.87335 WP_000171125.1.87355 WP_000171125.1.87573 WP_000171125.1.87602 WP_000171125.1.87804 WP_000171125.1.88230 WP_000171125.1.88283 WP_000171125.1.88292 WP_000171125.1.88350 WP_000171125.1.88556 WP_000171125.1.8867 WP_000171125.1.89144 WP_000171125.1.89441 WP_000171125.1.89447 WP_000171125.1.89719 WP_000171125.1.89822 WP_000171125.1.89889 WP_000171125.1.8997 WP_000171125.1.89995 WP_000171125.1.90133 WP_000171125.1.90227 WP_000171125.1.9040 WP_000171125.1.90437 WP_000171125.1.90675 WP_000171125.1.90774 WP_000171125.1.90889 WP_000171125.1.91247 WP_000171125.1.91262 WP_000171125.1.91274 WP_000171125.1.91539 WP_000171125.1.91747 WP_000171125.1.91794 WP_000171125.1.91841 WP_000171125.1.92022 WP_000171125.1.92038 WP_000171125.1.92063 WP_000171125.1.92069 WP_000171125.1.92157 WP_000171125.1.92401 WP_000171125.1.92516 WP_000171125.1.92559 WP_000171125.1.92696 WP_000171125.1.92703 WP_000171125.1.92952 WP_000171125.1.92993 WP_000171125.1.9302 WP_000171125.1.93060 WP_000171125.1.93399 WP_000171125.1.93836 WP_000171125.1.93945 WP_000171125.1.94255 WP_000171125.1.94426 WP_000171125.1.94441 WP_000171125.1.94481 WP_000171125.1.94887 WP_000171125.1.95204 WP_000171125.1.95516 WP_000171125.1.95549 WP_000171125.1.9561 WP_000171125.1.95662 WP_000171125.1.95733 WP_000171125.1.95818 WP_000171125.1.95976 WP_000171125.1.9607 WP_000171125.1.96089 WP_000171125.1.96187 WP_000171125.1.96311 WP_000171125.1.96471 WP_000171125.1.9660 WP_000171125.1.96687 WP_000171125.1.96693 WP_000171125.1.96704 WP_000171125.1.96980 WP_000171125.1.97100 WP_000171125.1.97144 WP_000171125.1.97405 WP_000171125.1.97516 WP_000171125.1.97552 WP_000171125.1.97562 WP_000171125.1.97650 WP_000171125.1.97799 WP_000171125.1.97832 WP_000171125.1.9787 WP_000171125.1.98021 WP_000171125.1.98116 WP_000171125.1.98172 WP_000171125.1.98246 WP_000171125.1.98280 WP_000171125.1.98624 WP_000171125.1.98642 WP_000171125.1.99128 WP_000171125.1.99204 WP_000171125.1.99417 WP_000171125.1.99452 WP_000171125.1.995 WP_000171125.1.99861 WP_000171125.1.99872 WP_000171125.1.99949 WP_000171125.1.99992 gi|384422842|ref|YP_005632201.1| gi|360037423|ref|YP_004939185.1| gi|147672493|ref|YP_001215293.1| gi|147672493|ref|YP_001215293.1| gi|379743949|ref|YP_005335001.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]