SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227812221|ref|YP_002812231.1| from Vibrio cholerae M66-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227812221|ref|YP_002812231.1|
Domain Number 1 Region: 58-318
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.61e-57
Family L-arabinose binding protein-like 0.0000877
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.9e-16
Family GalR/LacI-like bacterial regulator 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|227812221|ref|YP_002812231.1|
Sequence length 330
Comment sucrose operon repressor ScrR [Vibrio cholerae M66-2]
Sequence
MASLHDVARLAGVSKSTVSRVINDEYGVKESTKIKVLKAVEQCGYMVNQVAKDLKSQKTN
LIGVIVPRVSSHATAQGVDGLTAIFEQAGKHVLLANTHQVHAKEIEYIQIFNQKRVEGIV
FYATHLDQPLVHAIQHSAVPVVLVGQDGSLYNIPSIVHDDHRVGFEAGQRLVKAGCKQIG
FIGVQSDDIAVDVLRSQGLQQALGFHQQTLLFHARGNFSIESGYQMAKQAYLDYPQLDGL
FCATDRLAVGAIKALQELGVHVGQQVKLLGVGNDELAYVSNPPLSTFNYAFDKAGENAAK
MLLERIAGRGQEMSKVVLTFQNIQRETCPV
Download sequence
Identical sequences A0A0H3Q1P7 A0A0H6RUI7 A0A0K9UR59 A0A0X1L0A4 C3LVR9 Q9KLT7
gi|360037551|ref|YP_004939313.1| 243277.VCA0654 579112.VCM66_A0612 593588.VCD_000668 gi|229605720|ref|YP_002876424.1| gi|227812221|ref|YP_002812231.1| NYSGXRC-11014h gi|15601412|ref|NP_233043.1| NP_233043.1.72393 WP_000157570.1.100264 WP_000157570.1.100388 WP_000157570.1.100440 WP_000157570.1.10071 WP_000157570.1.100976 WP_000157570.1.101117 WP_000157570.1.10121 WP_000157570.1.101220 WP_000157570.1.101314 WP_000157570.1.101507 WP_000157570.1.101933 WP_000157570.1.102054 WP_000157570.1.1024 WP_000157570.1.10626 WP_000157570.1.10834 WP_000157570.1.10887 WP_000157570.1.11270 WP_000157570.1.11879 WP_000157570.1.11885 WP_000157570.1.11965 WP_000157570.1.12252 WP_000157570.1.12262 WP_000157570.1.12332 WP_000157570.1.12525 WP_000157570.1.12527 WP_000157570.1.12548 WP_000157570.1.12590 WP_000157570.1.12686 WP_000157570.1.13053 WP_000157570.1.13155 WP_000157570.1.13156 WP_000157570.1.13454 WP_000157570.1.13652 WP_000157570.1.13725 WP_000157570.1.14080 WP_000157570.1.14257 WP_000157570.1.14263 WP_000157570.1.14904 WP_000157570.1.14995 WP_000157570.1.15109 WP_000157570.1.15179 WP_000157570.1.15200 WP_000157570.1.15516 WP_000157570.1.15786 WP_000157570.1.15997 WP_000157570.1.16351 WP_000157570.1.16382 WP_000157570.1.17232 WP_000157570.1.17295 WP_000157570.1.17621 WP_000157570.1.18375 WP_000157570.1.18392 WP_000157570.1.18447 WP_000157570.1.18484 WP_000157570.1.18577 WP_000157570.1.18862 WP_000157570.1.18916 WP_000157570.1.19126 WP_000157570.1.19128 WP_000157570.1.19442 WP_000157570.1.19503 WP_000157570.1.19597 WP_000157570.1.20065 WP_000157570.1.20107 WP_000157570.1.20379 WP_000157570.1.20404 WP_000157570.1.20602 WP_000157570.1.20699 WP_000157570.1.20758 WP_000157570.1.21073 WP_000157570.1.21281 WP_000157570.1.21558 WP_000157570.1.21671 WP_000157570.1.21717 WP_000157570.1.21764 WP_000157570.1.21815 WP_000157570.1.21866 WP_000157570.1.22521 WP_000157570.1.22773 WP_000157570.1.229 WP_000157570.1.23333 WP_000157570.1.2341 WP_000157570.1.23416 WP_000157570.1.23424 WP_000157570.1.23538 WP_000157570.1.2354 WP_000157570.1.23808 WP_000157570.1.23955 WP_000157570.1.240 WP_000157570.1.2401 WP_000157570.1.24106 WP_000157570.1.24280 WP_000157570.1.24345 WP_000157570.1.24399 WP_000157570.1.24980 WP_000157570.1.26020 WP_000157570.1.26156 WP_000157570.1.2627 WP_000157570.1.26326 WP_000157570.1.26508 WP_000157570.1.26580 WP_000157570.1.27186 WP_000157570.1.27435 WP_000157570.1.27458 WP_000157570.1.27639 WP_000157570.1.27863 WP_000157570.1.28431 WP_000157570.1.2849 WP_000157570.1.29095 WP_000157570.1.29535 WP_000157570.1.29708 WP_000157570.1.29889 WP_000157570.1.30107 WP_000157570.1.30292 WP_000157570.1.3032 WP_000157570.1.30360 WP_000157570.1.3054 WP_000157570.1.30927 WP_000157570.1.31096 WP_000157570.1.31718 WP_000157570.1.32264 WP_000157570.1.32271 WP_000157570.1.32814 WP_000157570.1.32955 WP_000157570.1.33019 WP_000157570.1.33093 WP_000157570.1.33625 WP_000157570.1.33811 WP_000157570.1.33819 WP_000157570.1.34108 WP_000157570.1.34195 WP_000157570.1.34634 WP_000157570.1.3514 WP_000157570.1.35201 WP_000157570.1.35266 WP_000157570.1.35630 WP_000157570.1.35880 WP_000157570.1.35881 WP_000157570.1.3635 WP_000157570.1.36441 WP_000157570.1.36513 WP_000157570.1.36668 WP_000157570.1.36686 WP_000157570.1.36874 WP_000157570.1.36973 WP_000157570.1.37054 WP_000157570.1.37260 WP_000157570.1.37262 WP_000157570.1.37537 WP_000157570.1.37676 WP_000157570.1.37784 WP_000157570.1.37999 WP_000157570.1.38420 WP_000157570.1.38590 WP_000157570.1.39514 WP_000157570.1.39675 WP_000157570.1.39853 WP_000157570.1.39933 WP_000157570.1.40039 WP_000157570.1.40152 WP_000157570.1.40433 WP_000157570.1.40459 WP_000157570.1.40470 WP_000157570.1.40484 WP_000157570.1.40491 WP_000157570.1.40542 WP_000157570.1.40740 WP_000157570.1.41573 WP_000157570.1.4175 WP_000157570.1.41883 WP_000157570.1.42128 WP_000157570.1.42152 WP_000157570.1.42498 WP_000157570.1.42617 WP_000157570.1.4272 WP_000157570.1.4284 WP_000157570.1.42853 WP_000157570.1.42865 WP_000157570.1.42885 WP_000157570.1.43103 WP_000157570.1.43222 WP_000157570.1.43335 WP_000157570.1.4365 WP_000157570.1.43884 WP_000157570.1.439 WP_000157570.1.44569 WP_000157570.1.44709 WP_000157570.1.44730 WP_000157570.1.45055 WP_000157570.1.45127 WP_000157570.1.45155 WP_000157570.1.45206 WP_000157570.1.45264 WP_000157570.1.45372 WP_000157570.1.45704 WP_000157570.1.45842 WP_000157570.1.45903 WP_000157570.1.46118 WP_000157570.1.46146 WP_000157570.1.4661 WP_000157570.1.47202 WP_000157570.1.4730 WP_000157570.1.4731 WP_000157570.1.47417 WP_000157570.1.47428 WP_000157570.1.47736 WP_000157570.1.47796 WP_000157570.1.47846 WP_000157570.1.47942 WP_000157570.1.48128 WP_000157570.1.48715 WP_000157570.1.488 WP_000157570.1.48927 WP_000157570.1.49238 WP_000157570.1.49317 WP_000157570.1.50277 WP_000157570.1.50577 WP_000157570.1.50625 WP_000157570.1.50813 WP_000157570.1.50822 WP_000157570.1.50980 WP_000157570.1.51160 WP_000157570.1.51177 WP_000157570.1.51661 WP_000157570.1.5201 WP_000157570.1.52391 WP_000157570.1.5320 WP_000157570.1.53214 WP_000157570.1.5397 WP_000157570.1.54191 WP_000157570.1.5425 WP_000157570.1.54398 WP_000157570.1.5450 WP_000157570.1.54706 WP_000157570.1.54901 WP_000157570.1.55092 WP_000157570.1.55665 WP_000157570.1.55929 WP_000157570.1.55932 WP_000157570.1.56429 WP_000157570.1.56785 WP_000157570.1.57148 WP_000157570.1.57300 WP_000157570.1.57518 WP_000157570.1.57546 WP_000157570.1.57678 WP_000157570.1.57945 WP_000157570.1.58295 WP_000157570.1.58596 WP_000157570.1.58844 WP_000157570.1.58975 WP_000157570.1.59010 WP_000157570.1.59194 WP_000157570.1.59378 WP_000157570.1.59394 WP_000157570.1.5943 WP_000157570.1.59554 WP_000157570.1.59633 WP_000157570.1.59741 WP_000157570.1.59916 WP_000157570.1.60386 WP_000157570.1.60633 WP_000157570.1.60694 WP_000157570.1.60955 WP_000157570.1.61169 WP_000157570.1.61523 WP_000157570.1.61644 WP_000157570.1.61753 WP_000157570.1.61869 WP_000157570.1.61875 WP_000157570.1.61935 WP_000157570.1.62165 WP_000157570.1.62324 WP_000157570.1.62425 WP_000157570.1.63347 WP_000157570.1.63546 WP_000157570.1.63655 WP_000157570.1.6366 WP_000157570.1.63723 WP_000157570.1.63749 WP_000157570.1.63779 WP_000157570.1.63911 WP_000157570.1.64201 WP_000157570.1.64253 WP_000157570.1.64315 WP_000157570.1.64382 WP_000157570.1.64441 WP_000157570.1.65007 WP_000157570.1.65051 WP_000157570.1.65086 WP_000157570.1.66329 WP_000157570.1.66633 WP_000157570.1.66696 WP_000157570.1.67616 WP_000157570.1.68424 WP_000157570.1.68506 WP_000157570.1.68723 WP_000157570.1.68925 WP_000157570.1.69049 WP_000157570.1.69843 WP_000157570.1.69857 WP_000157570.1.70069 WP_000157570.1.70176 WP_000157570.1.70247 WP_000157570.1.7049 WP_000157570.1.70813 WP_000157570.1.70892 WP_000157570.1.71129 WP_000157570.1.72106 WP_000157570.1.72241 WP_000157570.1.72326 WP_000157570.1.72361 WP_000157570.1.72369 WP_000157570.1.7238 WP_000157570.1.72480 WP_000157570.1.72856 WP_000157570.1.73148 WP_000157570.1.73429 WP_000157570.1.73555 WP_000157570.1.73855 WP_000157570.1.73929 WP_000157570.1.74111 WP_000157570.1.74503 WP_000157570.1.74666 WP_000157570.1.74991 WP_000157570.1.75012 WP_000157570.1.75326 WP_000157570.1.75378 WP_000157570.1.75778 WP_000157570.1.76425 WP_000157570.1.76486 WP_000157570.1.7654 WP_000157570.1.76645 WP_000157570.1.77029 WP_000157570.1.7717 WP_000157570.1.77355 WP_000157570.1.77397 WP_000157570.1.77445 WP_000157570.1.77703 WP_000157570.1.77794 WP_000157570.1.77830 WP_000157570.1.77914 WP_000157570.1.78157 WP_000157570.1.78531 WP_000157570.1.79044 WP_000157570.1.79776 WP_000157570.1.79943 WP_000157570.1.80024 WP_000157570.1.8023 WP_000157570.1.80339 WP_000157570.1.80500 WP_000157570.1.80618 WP_000157570.1.80628 WP_000157570.1.80702 WP_000157570.1.80744 WP_000157570.1.80808 WP_000157570.1.8117 WP_000157570.1.81871 WP_000157570.1.81917 WP_000157570.1.82119 WP_000157570.1.82193 WP_000157570.1.82248 WP_000157570.1.82262 WP_000157570.1.82413 WP_000157570.1.82583 WP_000157570.1.83040 WP_000157570.1.83073 WP_000157570.1.83082 WP_000157570.1.83109 WP_000157570.1.83703 WP_000157570.1.83761 WP_000157570.1.84385 WP_000157570.1.84519 WP_000157570.1.84610 WP_000157570.1.8480 WP_000157570.1.85007 WP_000157570.1.85086 WP_000157570.1.85388 WP_000157570.1.85498 WP_000157570.1.85822 WP_000157570.1.85878 WP_000157570.1.85961 WP_000157570.1.85972 WP_000157570.1.85998 WP_000157570.1.86057 WP_000157570.1.86192 WP_000157570.1.86269 WP_000157570.1.86874 WP_000157570.1.86879 WP_000157570.1.87274 WP_000157570.1.87286 WP_000157570.1.87335 WP_000157570.1.87355 WP_000157570.1.87573 WP_000157570.1.87602 WP_000157570.1.87804 WP_000157570.1.88057 WP_000157570.1.88230 WP_000157570.1.88283 WP_000157570.1.88350 WP_000157570.1.88556 WP_000157570.1.8867 WP_000157570.1.89144 WP_000157570.1.89441 WP_000157570.1.89447 WP_000157570.1.89822 WP_000157570.1.89889 WP_000157570.1.8997 WP_000157570.1.89995 WP_000157570.1.90133 WP_000157570.1.90227 WP_000157570.1.90437 WP_000157570.1.90675 WP_000157570.1.90774 WP_000157570.1.90889 WP_000157570.1.91247 WP_000157570.1.91262 WP_000157570.1.91274 WP_000157570.1.91539 WP_000157570.1.91747 WP_000157570.1.91794 WP_000157570.1.91841 WP_000157570.1.92038 WP_000157570.1.92063 WP_000157570.1.92069 WP_000157570.1.92157 WP_000157570.1.92401 WP_000157570.1.92516 WP_000157570.1.92559 WP_000157570.1.92696 WP_000157570.1.92703 WP_000157570.1.92952 WP_000157570.1.92993 WP_000157570.1.9302 WP_000157570.1.93060 WP_000157570.1.93399 WP_000157570.1.93836 WP_000157570.1.93945 WP_000157570.1.94426 WP_000157570.1.94441 WP_000157570.1.94481 WP_000157570.1.94887 WP_000157570.1.95549 WP_000157570.1.9561 WP_000157570.1.95662 WP_000157570.1.95733 WP_000157570.1.95976 WP_000157570.1.9607 WP_000157570.1.96089 WP_000157570.1.96187 WP_000157570.1.96311 WP_000157570.1.96471 WP_000157570.1.9660 WP_000157570.1.96687 WP_000157570.1.96704 WP_000157570.1.96980 WP_000157570.1.97100 WP_000157570.1.97144 WP_000157570.1.97552 WP_000157570.1.97650 WP_000157570.1.97799 WP_000157570.1.97832 WP_000157570.1.9787 WP_000157570.1.98021 WP_000157570.1.98116 WP_000157570.1.98172 WP_000157570.1.98246 WP_000157570.1.98280 WP_000157570.1.98624 WP_000157570.1.98642 WP_000157570.1.99128 WP_000157570.1.99204 WP_000157570.1.99417 WP_000157570.1.99452 WP_000157570.1.995 WP_000157570.1.99861 WP_000157570.1.99872 WP_000157570.1.99949 WP_000157570.1.99992 gi|379744074|ref|YP_005335126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]