SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258539842|ref|YP_003174341.1| from Lactobacillus rhamnosus Lc 705

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258539842|ref|YP_003174341.1|
Domain Number 1 Region: 4-203
Classification Level Classification E-value
Superfamily Formyltransferase 2.62e-60
Family Formyltransferase 0.00000508
Further Details:      
 
Domain Number 2 Region: 205-307
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.35e-20
Family Post formyltransferase domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258539842|ref|YP_003174341.1|
Sequence length 318
Comment methionyl-tRNA formyltransferase [Lactobacillus rhamnosus Lc 705]
Sequence
MTSVIFLGTPDFAVPILEGLIAQHYDVVAVMTQPDRKVGRKQKLAASPVKQAAVAHNIPV
LQPEKLSGSPELAQAIALAPDLIVTAAYGQFLPTKFLQAAKIAAVNVHGSLLPKYRGGAP
IQYSIINGDAETGVTIIEMVKKMDAGDMFAQAKLPLTRQDDTGTVFAKLSLLGRDLLLAT
LPKIIDQTAIRTPQDPEKVTFAPTITKEQEHLDIHLSARALDQWVRGLRPEVGGYVYMNG
QRTKLWAITPLTATTNLPAGSVVARSKHQLVIAAGKPSTFHIDELPPAGKSQQHIADYLN
GPGRHLTVGQQVITDDPE
Download sequence
Identical sequences gi|258539842|ref|YP_003174341.1| WP_015764493.1.87509 568704.LC705_01651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]