SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|224476360|ref|YP_002633966.1| from Staphylococcus carnosus subsp. carnosus TM300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224476360|ref|YP_002633966.1|
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 8.37e-16
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|224476360|ref|YP_002633966.1|
Sequence length 135
Comment putative effector domain of transcriptional regulator [Staphylococcus carnosus subsp. carnosus TM300]
Sequence
MEYEIKHIDSTNVIGILSKYATMQDAQQGLPKAWEAFNNSDKPEELKALSNAVTSDKKSV
ADLHPYTLPEGDYIVADAIGPLPYTLQKTTEQLYNPNFLSDLGYRHRDAPGIELYPHGNT
QVDDYVAQVWVPIEN
Download sequence
Identical sequences B9DPH8
gi|224476360|ref|YP_002633966.1| 396513.Sca_0871 WP_015900122.1.31717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]