SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|224476618|ref|YP_002634224.1| from Staphylococcus carnosus subsp. carnosus TM300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224476618|ref|YP_002634224.1|
Domain Number 1 Region: 130-281
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000000889
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.035
Further Details:      
 
Domain Number 2 Region: 5-54
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000354
Family AraC type transcriptional activator 0.016
Further Details:      
 
Domain Number 3 Region: 58-104
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000762
Family AraC type transcriptional activator 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|224476618|ref|YP_002634224.1|
Sequence length 287
Comment AraC family transcriptional regulator [Staphylococcus carnosus subsp. carnosus TM300]
Sequence
MDVIKQIQQAIVYIEDRIIEPFHLQDLSDYVGLSPMHLDQSFKMIVGQSPSEYAKARKLT
KAAEDVIQGSYRLVDIAKKYHYKDTNEFANDFSDYHGVSPIQAKIKQDELQMQKRLYIKI
STTDRPPYTYRLETSDAYTLVGHARFINTEDLSNPFVVADFIEELLNDGRIEELQKYNDI
SPHELFIVKCPLDNGAEIFAGVPSERYPAHLESRYLPSRQYAKFNLQGEIDFAVNEAWHY
IETRLQLTLPYEHNSLYVEIYPFNISFEDPFTKIQLWIPIDPDVNNE
Download sequence
Identical sequences B9DNT3
gi|224476618|ref|YP_002634224.1| 396513.Sca_1131 WP_015900380.1.31717 WP_015900380.1.3311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]