SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|224476854|ref|YP_002634460.1| from Staphylococcus carnosus subsp. carnosus TM300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224476854|ref|YP_002634460.1|
Domain Number 1 Region: 36-303
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.45e-63
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|224476854|ref|YP_002634460.1|
Sequence length 331
Comment hypothetical protein Sca_1371 [Staphylococcus carnosus subsp. carnosus TM300]
Sequence
MSLVKDFFIGLSNNTFLNNSAKKYGPVLGASKVVVGNSLDDLIKTIRELNDKGITVTVDC
LGEFVGTEEESLIEKNIILKVLQAMHDNDVKAHLSIKISQLGAEFDLDLAEKNLREIVAK
AKELDNRHVNIDTEKFAGLDDILHVLDDISKDYDNVGTVIQAYLYTATDMVEKYPHIRLR
LVKGAYKENASIAYQNKEDIDANYISLIEKRLKNAKNFTSIATHDDKIIDHVKKFVEENN
ISRDDFEFQMLFGFRTDLAYAIADDNYNFCIYVPFGDDWFGYFMRRLAERPQNLNLAVKE
FVKPKSLAITAGAIAAVIGVTSAATALIKKR
Download sequence
Identical sequences B9DN28
396513.Sca_1371 WP_015900615.1.31717 WP_015900615.1.3311 gi|224476854|ref|YP_002634460.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]