SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229818873|ref|YP_002880399.1| from Beutenbergia cavernae DSM 12333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229818873|ref|YP_002880399.1|
Domain Number 1 Region: 24-242
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 6.67e-43
Family Phosphoglucomutase, first 3 domains 0.0024
Further Details:      
 
Domain Number 2 Region: 320-462
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.29e-31
Family Phosphoglucomutase, first 3 domains 0.0039
Further Details:      
 
Domain Number 3 Region: 450-558
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 3.92e-18
Family Phosphoglucomutase, C-terminal domain 0.0046
Further Details:      
 
Domain Number 4 Region: 217-333
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.0000000000000589
Family Phosphoglucomutase, first 3 domains 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229818873|ref|YP_002880399.1|
Sequence length 559
Comment phosphoglucomutase [Beutenbergia cavernae DSM 12333]
Sequence
MHPRAGQPAQPEDLIDVAQVVGAYYDRVPDPDDPAQQVVFGTSGHRGSSLDGAFTETHIA
AITAAIVEYRRSQGTDGPLYIGRDTHALSEPAWRTALEVLAAAEVDVRIDARGSWTPTPA
VSHSILRHNGAGSLAGVRTQGPELADGIVVTPSHNPPRDGGFKYNPPDGGPAGSEATSWI
ARRANELVRSGLAAIARVPFERAVAAPTTARHDYLLTYVDDLDAVVDLDRIREAGVRIGA
DPLGGASVEYWAAIAERHRLDLTVVNPEVDPRWAFMTLDWDGKIRMDCSSPSAMASLVRT
MTPDAGGKVPYDVATGNDADADRHGIVTPDGGLMNPNHYLAVAIDYLFRSREGWPAAAGV
GKTLVSSALIDRVARALSRRLVEVPVGFKWFVPGLLDGAVAFGGEESAGASFLRTDGSVW
TTDKDGILLALLAAEITAATGASPSAYHARLAEQHGESWYARVDAPATREQKARLGALAP
EDVTATELAGEPIAERLVTAPGNGAPIGGLKVTTASAWFAARPSGTEDVYKIYAESFAGP
EHLAQVQDAAREVVDAALA
Download sequence
Identical sequences C5BWH9
WP_012725417.1.13559 471853.Bcav_0373 gi|229818873|ref|YP_002880399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]