SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229819801|ref|YP_002881327.1| from Beutenbergia cavernae DSM 12333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229819801|ref|YP_002881327.1|
Domain Number 1 Region: 6-294
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 9.16e-73
Family ATP synthase (F1-ATPase), gamma subunit 0.000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229819801|ref|YP_002881327.1|
Sequence length 297
Comment ATP synthase F1 subunit gamma [Beutenbergia cavernae DSM 12333]
Sequence
MAGAQRVYKQRIRSTQTLKKMFRAMELIAASRITRAREHARAAAPYSRALTRAVSAVATH
TQIDHPLTTDRADTNRVAMLVVTADRGQAGAYNTTILREAERLAAQLIEEGKEPQLYVTG
RRGVGYYTFRHREIVKSWTGGSDNPEVSTAEEIADTLLEAFRAPVAEGGVSEIHLVYTRF
ASMVSQEPRVVRMLPLEVVEGVVEAGGDVLPLYEFEPSPEAVLDALLPRYIRSRVFNALL
QASASELAARQRAMHTATENAEDLIRKYTRLANTARQAEITQEISEIVSGADAMAAS
Download sequence
Identical sequences C5C1U7
WP_015881805.1.13559 gi|229819801|ref|YP_002881327.1| 471853.Bcav_1306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]