SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229821236|ref|YP_002882762.1| from Beutenbergia cavernae DSM 12333

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|229821236|ref|YP_002882762.1|
Domain Number - Region: 319-362
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.0561
Family Heme-dependent catalases 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229821236|ref|YP_002882762.1|
Sequence length 459
Comment hypothetical protein Bcav_2755 [Beutenbergia cavernae DSM 12333]
Sequence
MPEQSWHEARLIPTSGINGADEQERRATSALLAVMSIVREFGRALTKPYGAPAGAIQTFI
EVPFEVGERRIFPDGLIRITRGQSVWTTLVEVKTGNNLLHADQLENYLDIAREQGYNAVL
TISNEIPPIAGQHPTRVDKRKLRRVDLHHLSWTQVLAEAVMQKEFRGVADPDQAWILGEL
IRYLEHPRSGAMEFEDMGEAWVPVRNGVKTGTLRPTDKGASEVAARFDALLRFVSLNLGR
QLGTEVSPVVSRRELADPSLRAQALVEDLTSAGVLTGSIRIPSTVGDIVVAADVRAGTIV
CHIDVDAPRQGRPTTRVNWLVRQLKNAPESVRIEARAAHSRGAGAVGLLKAIRDDPSQLV
ADPAKEIRAFQVATVTPMGTKRGRGRGAFIDSVIEAVDVFYADVVQHLKAWSAAPPRLRP
EIEPATAGPDGVSPGLPSTGLSSQDDETLTSSTQASSPS
Download sequence
Identical sequences C5BYA0
471853.Bcav_2755 WP_015883240.1.13559 gi|229821236|ref|YP_002882762.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]