SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229821415|ref|YP_002882941.1| from Beutenbergia cavernae DSM 12333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229821415|ref|YP_002882941.1|
Domain Number 1 Region: 46-205
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.41e-36
Family Phosphoglucomutase, first 3 domains 0.0013
Further Details:      
 
Domain Number 2 Region: 312-457
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.47e-24
Family Phosphoglucomutase, first 3 domains 0.0053
Further Details:      
 
Domain Number 3 Region: 222-323
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.98e-22
Family Phosphoglucomutase, first 3 domains 0.002
Further Details:      
 
Domain Number 4 Region: 463-575
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.000000000000249
Family Phosphoglucomutase, C-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229821415|ref|YP_002882941.1|
Sequence length 591
Comment phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Beutenbergia cavernae DSM 12333]
Sequence
MTALDDDVAARAAAWIDDDPDPAAAAELTAVLAAARAGDPDAVVDLADRFSGPLEFGTAG
LRGPLGAGEHRMNRAVVIRAAAGLSAFLAAELPGERPRVVIGFDARHGSAQFARDTAAVV
TAAGGEAILLARAWPTPVLAFAVRQLDADAGVMVTASHNPPADNGYKVYLGGRVVTDAGQ
GAQIVPPYDAAIASRIAAVDAVASVPRATEGWTTLGEAVLEDYLVRAAGLAAPGSADLRI
VLTPLHGVGGAAAAEALRRAGFDDVHVVAAQAAPDPDFPTVAFPNPEEPGALDLAFALAR
DVSADLVLAVDPDADRCGVAVPDAAAAERWRRLSGDDVGALLGAQAAALAVAGGAGAEPE
PPVLASSIVSSRLLARIAAAHGLRHRSTLTGFKWISRVPGLAYGYEEALGYCVDPAAVRD
KDGISAAVRVASLAAALRAENRSLDDALDDLAREHGLHVTAPLTVRVDDLALIPAAMRRL
REHPPTSLAGSPVVRSVDLTLGLRVATPEGHYDVPPTEGLLYETQDGDRVIVRPSGTEPK
LKAYLEVVQEVGPGDLAPARADAAARLADITADLRRAIGLDGTAAGTPTSR
Download sequence
Identical sequences C5BZ64
471853.Bcav_2934 gi|229821415|ref|YP_002882941.1| WP_015883419.1.13559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]