SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229821877|ref|YP_002883403.1| from Beutenbergia cavernae DSM 12333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229821877|ref|YP_002883403.1|
Domain Number 1 Region: 65-333
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.37e-49
Family L-arabinose binding protein-like 0.0000547
Further Details:      
 
Domain Number 2 Region: 5-62
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000819
Family GalR/LacI-like bacterial regulator 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229821877|ref|YP_002883403.1|
Sequence length 338
Comment LacI family transcriptional regulator [Beutenbergia cavernae DSM 12333]
Sequence
MSPERPGVREIARLAGVSTATVSRVYRGVGQVSPEMRERVLSAIETHGYRPSSFGRALSR
RRHEAVGIVFPGLSGPYFAELIQGFEAVALEARASVHVVGTHLLRSADADVRALADHVDG
IAVHAGTLPSEVVDELAELMPLVVLGATPDERHTSVRTDHAPVLDLVEHLITDHGLRDLV
FFGDPDGPPDVAARWDGFRAAHERHGLVPVREPLDLGLAFDDGLLAADAVLAPEHRRIDG
VVCANDETALGFLMGALGRGVRVPEDVVVVGIDDVPMSSVVRPALTTVARPLRELAETSA
RLLLDLVEGRDVPGETVLPSSLVIRTSCGCPPAAPAPA
Download sequence
Identical sequences C5C216
WP_015883878.1.13559 gi|229821877|ref|YP_002883403.1| 471853.Bcav_3399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]