SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470190454|ref|YP_007576764.1| from Staphylococcus aureus ST228/10388

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470190454|ref|YP_007576764.1|
Domain Number 1 Region: 5-244
Classification Level Classification E-value
Superfamily SIS domain 1.31e-67
Family mono-SIS domain 0.000000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470190454|ref|YP_007576764.1|
Sequence length 298
Comment N-acetylmuramic acid-6-phosphate etherase [Staphylococcus aureus subsp. aureus ST228]
Sequence
MENSTTEARNEATMHLDEMTVEEALITMNKEDQQVPLAVRKAIPQLTKVIKKTIAQYKKG
GRLIYIGAGTSGRLGVLDAAECVPTFNTDPHEIIGIIAGGQHAMTMAVEGAEDHKKLAEE
DLKNIDLTSKDVVIGIAASGKTPYVIGGLTFANTIGATTVSISCNEHAVISEIAQYPVEV
KVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNLMIDVKATNQKLIDRSVRII
QEICAITYDEAMALYQVSEHDVKVATVMGMCGISKEEATRRLLNNGDIVKRAIRDRQP
Download sequence
Identical sequences A0A0E1ACP5 A0A0E1XKH4 A0A1E8XBB7 A0A2K4DXL9 W8U2B2
gi|384868754|ref|YP_005751468.1| gi|554642996|ref|YP_008714787.1| WP_000432017.1.100013 WP_000432017.1.100041 WP_000432017.1.100049 WP_000432017.1.100057 WP_000432017.1.10006 WP_000432017.1.100067 WP_000432017.1.100075 WP_000432017.1.100088 WP_000432017.1.100090 WP_000432017.1.100094 WP_000432017.1.100096 WP_000432017.1.100154 WP_000432017.1.100171 WP_000432017.1.100180 WP_000432017.1.100184 WP_000432017.1.100189 WP_000432017.1.100235 WP_000432017.1.100298 WP_000432017.1.100307 WP_000432017.1.10032 WP_000432017.1.100335 WP_000432017.1.100366 WP_000432017.1.100399 WP_000432017.1.10041 WP_000432017.1.10046 WP_000432017.1.10050 WP_000432017.1.100507 WP_000432017.1.100527 WP_000432017.1.100560 WP_000432017.1.100582 WP_000432017.1.100596 WP_000432017.1.100604 WP_000432017.1.100613 WP_000432017.1.100618 WP_000432017.1.100631 WP_000432017.1.100647 WP_000432017.1.100665 WP_000432017.1.100693 WP_000432017.1.100699 WP_000432017.1.100704 WP_000432017.1.100719 WP_000432017.1.100761 WP_000432017.1.100768 WP_000432017.1.100785 WP_000432017.1.100832 WP_000432017.1.100834 WP_000432017.1.100888 WP_000432017.1.1009 WP_000432017.1.100903 WP_000432017.1.100920 WP_000432017.1.100934 WP_000432017.1.100956 WP_000432017.1.100963 WP_000432017.1.10097 WP_000432017.1.100981 WP_000432017.1.100986 WP_000432017.1.100987 WP_000432017.1.101002 WP_000432017.1.101017 WP_000432017.1.101019 WP_000432017.1.101023 WP_000432017.1.101027 WP_000432017.1.101058 WP_000432017.1.101068 WP_000432017.1.101072 WP_000432017.1.101084 WP_000432017.1.101103 WP_000432017.1.10111 WP_000432017.1.101160 WP_000432017.1.101177 WP_000432017.1.101192 WP_000432017.1.101240 WP_000432017.1.101262 WP_000432017.1.101266 WP_000432017.1.101327 WP_000432017.1.101329 WP_000432017.1.101330 WP_000432017.1.101355 WP_000432017.1.101375 WP_000432017.1.101379 WP_000432017.1.101393 WP_000432017.1.101402 WP_000432017.1.101414 WP_000432017.1.101440 WP_000432017.1.101441 WP_000432017.1.101458 WP_000432017.1.10148 WP_000432017.1.101490 WP_000432017.1.1015 WP_000432017.1.101511 WP_000432017.1.101566 WP_000432017.1.101570 WP_000432017.1.101615 WP_000432017.1.101619 WP_000432017.1.101627 WP_000432017.1.101645 WP_000432017.1.10165 WP_000432017.1.101657 WP_000432017.1.10166 WP_000432017.1.101661 WP_000432017.1.101691 WP_000432017.1.101704 WP_000432017.1.101716 WP_000432017.1.101725 WP_000432017.1.101728 WP_000432017.1.101731 WP_000432017.1.101745 WP_000432017.1.101757 WP_000432017.1.101758 WP_000432017.1.101775 WP_000432017.1.101778 WP_000432017.1.101779 WP_000432017.1.101788 WP_000432017.1.101813 WP_000432017.1.101820 WP_000432017.1.101824 WP_000432017.1.101825 WP_000432017.1.101831 WP_000432017.1.101852 WP_000432017.1.101902 WP_000432017.1.101906 WP_000432017.1.101921 WP_000432017.1.101943 WP_000432017.1.101950 WP_000432017.1.102065 WP_000432017.1.102066 WP_000432017.1.102123 WP_000432017.1.102130 WP_000432017.1.102132 WP_000432017.1.10214 WP_000432017.1.1022 WP_000432017.1.10232 WP_000432017.1.10238 WP_000432017.1.10240 WP_000432017.1.10244 WP_000432017.1.10249 WP_000432017.1.1025 WP_000432017.1.10274 WP_000432017.1.10292 WP_000432017.1.10294 WP_000432017.1.10301 WP_000432017.1.1031 WP_000432017.1.10321 WP_000432017.1.10343 WP_000432017.1.10397 WP_000432017.1.10408 WP_000432017.1.10431 WP_000432017.1.10436 WP_000432017.1.10450 WP_000432017.1.10478 WP_000432017.1.10481 WP_000432017.1.10486 WP_000432017.1.10503 WP_000432017.1.1052 WP_000432017.1.10542 WP_000432017.1.10543 WP_000432017.1.10565 WP_000432017.1.10583 WP_000432017.1.10614 WP_000432017.1.10624 WP_000432017.1.10644 WP_000432017.1.10664 WP_000432017.1.10679 WP_000432017.1.10707 WP_000432017.1.10726 WP_000432017.1.10742 WP_000432017.1.10749 WP_000432017.1.10751 WP_000432017.1.1077 WP_000432017.1.10823 WP_000432017.1.10841 WP_000432017.1.10858 WP_000432017.1.1087 WP_000432017.1.10917 WP_000432017.1.10919 WP_000432017.1.10928 WP_000432017.1.10942 WP_000432017.1.10950 WP_000432017.1.10965 WP_000432017.1.10969 WP_000432017.1.10976 WP_000432017.1.10979 WP_000432017.1.10985 WP_000432017.1.10986 WP_000432017.1.11001 WP_000432017.1.11069 WP_000432017.1.11073 WP_000432017.1.11074 WP_000432017.1.11083 WP_000432017.1.11084 WP_000432017.1.11129 WP_000432017.1.1115 WP_000432017.1.11162 WP_000432017.1.11184 WP_000432017.1.1120 WP_000432017.1.11202 WP_000432017.1.11220 WP_000432017.1.11228 WP_000432017.1.11261 WP_000432017.1.11282 WP_000432017.1.11286 WP_000432017.1.11287 WP_000432017.1.11294 WP_000432017.1.11312 WP_000432017.1.11322 WP_000432017.1.11333 WP_000432017.1.11348 WP_000432017.1.11353 WP_000432017.1.1136 WP_000432017.1.11365 WP_000432017.1.11378 WP_000432017.1.11391 WP_000432017.1.11407 WP_000432017.1.11434 WP_000432017.1.11441 WP_000432017.1.11447 WP_000432017.1.11451 WP_000432017.1.1147 WP_000432017.1.11488 WP_000432017.1.11492 WP_000432017.1.11504 WP_000432017.1.1151 WP_000432017.1.11513 WP_000432017.1.11525 WP_000432017.1.11540 WP_000432017.1.11556 WP_000432017.1.11558 WP_000432017.1.11592 WP_000432017.1.11611 WP_000432017.1.11640 WP_000432017.1.11646 WP_000432017.1.11663 WP_000432017.1.11665 WP_000432017.1.11692 WP_000432017.1.117 WP_000432017.1.1171 WP_000432017.1.11719 WP_000432017.1.11720 WP_000432017.1.11723 WP_000432017.1.11730 WP_000432017.1.11736 WP_000432017.1.11768 WP_000432017.1.11795 WP_000432017.1.11816 WP_000432017.1.11829 WP_000432017.1.11837 WP_000432017.1.11894 WP_000432017.1.11903 WP_000432017.1.11904 WP_000432017.1.11969 WP_000432017.1.11991 WP_000432017.1.12005 WP_000432017.1.12026 WP_000432017.1.12029 WP_000432017.1.12042 WP_000432017.1.1205 WP_000432017.1.12073 WP_000432017.1.12098 WP_000432017.1.1210 WP_000432017.1.12123 WP_000432017.1.1213 WP_000432017.1.12149 WP_000432017.1.12152 WP_000432017.1.12158 WP_000432017.1.12170 WP_000432017.1.12175 WP_000432017.1.12179 WP_000432017.1.12181 WP_000432017.1.12201 WP_000432017.1.12226 WP_000432017.1.12234 WP_000432017.1.12256 WP_000432017.1.12297 WP_000432017.1.12328 WP_000432017.1.12330 WP_000432017.1.12361 WP_000432017.1.12366 WP_000432017.1.12436 WP_000432017.1.12437 WP_000432017.1.12447 WP_000432017.1.12498 WP_000432017.1.12516 WP_000432017.1.1252 WP_000432017.1.1253 WP_000432017.1.12555 WP_000432017.1.1257 WP_000432017.1.12608 WP_000432017.1.12618 WP_000432017.1.12639 WP_000432017.1.12685 WP_000432017.1.12711 WP_000432017.1.12715 WP_000432017.1.12733 WP_000432017.1.12737 WP_000432017.1.1276 WP_000432017.1.12771 WP_000432017.1.12772 WP_000432017.1.12780 WP_000432017.1.12788 WP_000432017.1.12822 WP_000432017.1.12829 WP_000432017.1.12833 WP_000432017.1.12845 WP_000432017.1.12862 WP_000432017.1.12884 WP_000432017.1.12886 WP_000432017.1.12903 WP_000432017.1.12904 WP_000432017.1.12920 WP_000432017.1.12937 WP_000432017.1.12938 WP_000432017.1.13013 WP_000432017.1.13039 WP_000432017.1.13062 WP_000432017.1.13091 WP_000432017.1.13104 WP_000432017.1.13154 WP_000432017.1.13164 WP_000432017.1.13169 WP_000432017.1.13189 WP_000432017.1.13243 WP_000432017.1.13250 WP_000432017.1.13307 WP_000432017.1.13317 WP_000432017.1.13322 WP_000432017.1.13355 WP_000432017.1.13379 WP_000432017.1.13405 WP_000432017.1.13448 WP_000432017.1.13468 WP_000432017.1.1347 WP_000432017.1.13486 WP_000432017.1.13501 WP_000432017.1.13505 WP_000432017.1.13514 WP_000432017.1.13532 WP_000432017.1.1355 WP_000432017.1.13554 WP_000432017.1.13556 WP_000432017.1.13557 WP_000432017.1.13568 WP_000432017.1.13612 WP_000432017.1.13617 WP_000432017.1.13650 WP_000432017.1.13654 WP_000432017.1.13665 WP_000432017.1.13668 WP_000432017.1.13670 WP_000432017.1.13683 WP_000432017.1.13709 WP_000432017.1.13726 WP_000432017.1.13727 WP_000432017.1.13734 WP_000432017.1.1374 WP_000432017.1.1375 WP_000432017.1.13755 WP_000432017.1.13757 WP_000432017.1.13772 WP_000432017.1.13804 WP_000432017.1.13805 WP_000432017.1.13807 WP_000432017.1.13831 WP_000432017.1.13879 WP_000432017.1.13897 WP_000432017.1.13904 WP_000432017.1.13914 WP_000432017.1.13933 WP_000432017.1.13940 WP_000432017.1.13947 WP_000432017.1.13983 WP_000432017.1.13986 WP_000432017.1.13987 WP_000432017.1.14025 WP_000432017.1.14034 WP_000432017.1.14071 WP_000432017.1.14097 WP_000432017.1.14112 WP_000432017.1.14143 WP_000432017.1.14153 WP_000432017.1.14163 WP_000432017.1.14192 WP_000432017.1.1420 WP_000432017.1.14201 WP_000432017.1.14221 WP_000432017.1.14233 WP_000432017.1.1426 WP_000432017.1.14272 WP_000432017.1.14302 WP_000432017.1.14305 WP_000432017.1.14314 WP_000432017.1.14355 WP_000432017.1.14358 WP_000432017.1.14364 WP_000432017.1.14365 WP_000432017.1.14366 WP_000432017.1.14372 WP_000432017.1.14394 WP_000432017.1.14397 WP_000432017.1.14412 WP_000432017.1.14418 WP_000432017.1.14475 WP_000432017.1.14535 WP_000432017.1.1457 WP_000432017.1.14577 WP_000432017.1.14596 WP_000432017.1.1468 WP_000432017.1.14696 WP_000432017.1.147 WP_000432017.1.1471 WP_000432017.1.14729 WP_000432017.1.14734 WP_000432017.1.14744 WP_000432017.1.1477 WP_000432017.1.14774 WP_000432017.1.14787 WP_000432017.1.14790 WP_000432017.1.14809 WP_000432017.1.14823 WP_000432017.1.14825 WP_000432017.1.14846 WP_000432017.1.14866 WP_000432017.1.14869 WP_000432017.1.14874 WP_000432017.1.14888 WP_000432017.1.14902 WP_000432017.1.14967 WP_000432017.1.14970 WP_000432017.1.14987 WP_000432017.1.15000 WP_000432017.1.15022 WP_000432017.1.15029 WP_000432017.1.15039 WP_000432017.1.15091 WP_000432017.1.15108 WP_000432017.1.15173 WP_000432017.1.15182 WP_000432017.1.15185 WP_000432017.1.1520 WP_000432017.1.15201 WP_000432017.1.15228 WP_000432017.1.15234 WP_000432017.1.1525 WP_000432017.1.15255 WP_000432017.1.15263 WP_000432017.1.15268 WP_000432017.1.15269 WP_000432017.1.15278 WP_000432017.1.15294 WP_000432017.1.15296 WP_000432017.1.15329 WP_000432017.1.15399 WP_000432017.1.15409 WP_000432017.1.15421 WP_000432017.1.15438 WP_000432017.1.1545 WP_000432017.1.15489 WP_000432017.1.15505 WP_000432017.1.15519 WP_000432017.1.15524 WP_000432017.1.15544 WP_000432017.1.15546 WP_000432017.1.15572 WP_000432017.1.1558 WP_000432017.1.15590 WP_000432017.1.1562 WP_000432017.1.1564 WP_000432017.1.15641 WP_000432017.1.15687 WP_000432017.1.15691 WP_000432017.1.15706 WP_000432017.1.15712 WP_000432017.1.15722 WP_000432017.1.15785 WP_000432017.1.1579 WP_000432017.1.15812 WP_000432017.1.15818 WP_000432017.1.1583 WP_000432017.1.15883 WP_000432017.1.15892 WP_000432017.1.15897 WP_000432017.1.15898 WP_000432017.1.159 WP_000432017.1.15920 WP_000432017.1.15925 WP_000432017.1.15972 WP_000432017.1.1599 WP_000432017.1.1600 WP_000432017.1.16018 WP_000432017.1.16026 WP_000432017.1.1606 WP_000432017.1.16068 WP_000432017.1.16083 WP_000432017.1.16095 WP_000432017.1.16096 WP_000432017.1.16098 WP_000432017.1.16112 WP_000432017.1.16114 WP_000432017.1.16140 WP_000432017.1.16173 WP_000432017.1.16195 WP_000432017.1.16203 WP_000432017.1.16213 WP_000432017.1.16214 WP_000432017.1.16223 WP_000432017.1.1623 WP_000432017.1.16237 WP_000432017.1.16251 WP_000432017.1.16265 WP_000432017.1.16276 WP_000432017.1.16283 WP_000432017.1.16311 WP_000432017.1.16362 WP_000432017.1.16395 WP_000432017.1.16407 WP_000432017.1.16408 WP_000432017.1.16414 WP_000432017.1.16433 WP_000432017.1.16455 WP_000432017.1.16458 WP_000432017.1.16554 WP_000432017.1.16564 WP_000432017.1.16569 WP_000432017.1.16589 WP_000432017.1.16603 WP_000432017.1.16606 WP_000432017.1.16617 WP_000432017.1.1662 WP_000432017.1.16628 WP_000432017.1.16632 WP_000432017.1.16639 WP_000432017.1.16649 WP_000432017.1.1665 WP_000432017.1.16651 WP_000432017.1.16653 WP_000432017.1.1666 WP_000432017.1.16664 WP_000432017.1.16672 WP_000432017.1.16679 WP_000432017.1.16684 WP_000432017.1.16688 WP_000432017.1.16693 WP_000432017.1.16703 WP_000432017.1.16747 WP_000432017.1.16757 WP_000432017.1.16761 WP_000432017.1.16762 WP_000432017.1.16768 WP_000432017.1.16770 WP_000432017.1.16776 WP_000432017.1.16794 WP_000432017.1.16802 WP_000432017.1.16815 WP_000432017.1.16833 WP_000432017.1.16892 WP_000432017.1.16925 WP_000432017.1.16936 WP_000432017.1.16938 WP_000432017.1.16946 WP_000432017.1.16969 WP_000432017.1.170 WP_000432017.1.17012 WP_000432017.1.17038 WP_000432017.1.17046 WP_000432017.1.17104 WP_000432017.1.17122 WP_000432017.1.17132 WP_000432017.1.17137 WP_000432017.1.17139 WP_000432017.1.17157 WP_000432017.1.17169 WP_000432017.1.17193 WP_000432017.1.17200 WP_000432017.1.17210 WP_000432017.1.17231 WP_000432017.1.17234 WP_000432017.1.17240 WP_000432017.1.17248 WP_000432017.1.17249 WP_000432017.1.1725 WP_000432017.1.17256 WP_000432017.1.17289 WP_000432017.1.17309 WP_000432017.1.17320 WP_000432017.1.17327 WP_000432017.1.1736 WP_000432017.1.1741 WP_000432017.1.17419 WP_000432017.1.17450 WP_000432017.1.17454 WP_000432017.1.17475 WP_000432017.1.17485 WP_000432017.1.17520 WP_000432017.1.17524 WP_000432017.1.17526 WP_000432017.1.17529 WP_000432017.1.1756 WP_000432017.1.17581 WP_000432017.1.17590 WP_000432017.1.17628 WP_000432017.1.17643 WP_000432017.1.1765 WP_000432017.1.17651 WP_000432017.1.17657 WP_000432017.1.17658 WP_000432017.1.17666 WP_000432017.1.17671 WP_000432017.1.17676 WP_000432017.1.17717 WP_000432017.1.17718 WP_000432017.1.17720 WP_000432017.1.17729 WP_000432017.1.17737 WP_000432017.1.17770 WP_000432017.1.17796 WP_000432017.1.17818 WP_000432017.1.17832 WP_000432017.1.17834 WP_000432017.1.17835 WP_000432017.1.17838 WP_000432017.1.17845 WP_000432017.1.17847 WP_000432017.1.17853 WP_000432017.1.17859 WP_000432017.1.1787 WP_000432017.1.17876 WP_000432017.1.17882 WP_000432017.1.17909 WP_000432017.1.17922 WP_000432017.1.17929 WP_000432017.1.17951 WP_000432017.1.17966 WP_000432017.1.18011 WP_000432017.1.18016 WP_000432017.1.18035 WP_000432017.1.18069 WP_000432017.1.18074 WP_000432017.1.18080 WP_000432017.1.18105 WP_000432017.1.1811 WP_000432017.1.18113 WP_000432017.1.18132 WP_000432017.1.18140 WP_000432017.1.18153 WP_000432017.1.18197 WP_000432017.1.18203 WP_000432017.1.18237 WP_000432017.1.18248 WP_000432017.1.18261 WP_000432017.1.18283 WP_000432017.1.1829 WP_000432017.1.18290 WP_000432017.1.18301 WP_000432017.1.18310 WP_000432017.1.18320 WP_000432017.1.1835 WP_000432017.1.18360 WP_000432017.1.18412 WP_000432017.1.18429 WP_000432017.1.18437 WP_000432017.1.18451 WP_000432017.1.18466 WP_000432017.1.1847 WP_000432017.1.1849 WP_000432017.1.18497 WP_000432017.1.18504 WP_000432017.1.18506 WP_000432017.1.18507 WP_000432017.1.1851 WP_000432017.1.18516 WP_000432017.1.18526 WP_000432017.1.18529 WP_000432017.1.18538 WP_000432017.1.18539 WP_000432017.1.18545 WP_000432017.1.18560 WP_000432017.1.18562 WP_000432017.1.18566 WP_000432017.1.18567 WP_000432017.1.18570 WP_000432017.1.18591 WP_000432017.1.18605 WP_000432017.1.18611 WP_000432017.1.18627 WP_000432017.1.18632 WP_000432017.1.18658 WP_000432017.1.18668 WP_000432017.1.18679 WP_000432017.1.18741 WP_000432017.1.18758 WP_000432017.1.18763 WP_000432017.1.18774 WP_000432017.1.18777 WP_000432017.1.18779 WP_000432017.1.18799 WP_000432017.1.18809 WP_000432017.1.18818 WP_000432017.1.18830 WP_000432017.1.18834 WP_000432017.1.18836 WP_000432017.1.18870 WP_000432017.1.18879 WP_000432017.1.18882 WP_000432017.1.18918 WP_000432017.1.1892 WP_000432017.1.18938 WP_000432017.1.18965 WP_000432017.1.18968 WP_000432017.1.18974 WP_000432017.1.18987 WP_000432017.1.19009 WP_000432017.1.1901 WP_000432017.1.19027 WP_000432017.1.19052 WP_000432017.1.19082 WP_000432017.1.1911 WP_000432017.1.1912 WP_000432017.1.19149 WP_000432017.1.19179 WP_000432017.1.192 WP_000432017.1.19272 WP_000432017.1.19301 WP_000432017.1.19322 WP_000432017.1.19365 WP_000432017.1.19370 WP_000432017.1.19386 WP_000432017.1.19390 WP_000432017.1.19411 WP_000432017.1.19430 WP_000432017.1.19444 WP_000432017.1.19450 WP_000432017.1.19455 WP_000432017.1.19497 WP_000432017.1.19509 WP_000432017.1.19515 WP_000432017.1.19577 WP_000432017.1.19611 WP_000432017.1.1964 WP_000432017.1.19643 WP_000432017.1.19701 WP_000432017.1.19717 WP_000432017.1.19725 WP_000432017.1.19732 WP_000432017.1.19733 WP_000432017.1.1974 WP_000432017.1.19748 WP_000432017.1.1975 WP_000432017.1.19765 WP_000432017.1.19775 WP_000432017.1.19788 WP_000432017.1.19792 WP_000432017.1.19801 WP_000432017.1.19816 WP_000432017.1.19848 WP_000432017.1.19853 WP_000432017.1.19891 WP_000432017.1.19905 WP_000432017.1.19912 WP_000432017.1.19921 WP_000432017.1.19928 WP_000432017.1.19968 WP_000432017.1.19977 WP_000432017.1.19980 WP_000432017.1.19981 WP_000432017.1.19982 WP_000432017.1.20006 WP_000432017.1.20049 WP_000432017.1.20052 WP_000432017.1.20057 WP_000432017.1.2007 WP_000432017.1.20078 WP_000432017.1.2008 WP_000432017.1.20090 WP_000432017.1.20100 WP_000432017.1.20101 WP_000432017.1.2013 WP_000432017.1.20155 WP_000432017.1.20156 WP_000432017.1.20160 WP_000432017.1.20161 WP_000432017.1.20191 WP_000432017.1.20201 WP_000432017.1.20210 WP_000432017.1.20214 WP_000432017.1.20219 WP_000432017.1.20221 WP_000432017.1.20235 WP_000432017.1.20245 WP_000432017.1.2025 WP_000432017.1.20265 WP_000432017.1.2029 WP_000432017.1.20324 WP_000432017.1.20340 WP_000432017.1.20354 WP_000432017.1.20358 WP_000432017.1.20386 WP_000432017.1.20394 WP_000432017.1.20398 WP_000432017.1.20399 WP_000432017.1.20411 WP_000432017.1.20447 WP_000432017.1.20473 WP_000432017.1.20479 WP_000432017.1.20487 WP_000432017.1.20496 WP_000432017.1.20512 WP_000432017.1.20554 WP_000432017.1.2056 WP_000432017.1.20579 WP_000432017.1.20585 WP_000432017.1.20598 WP_000432017.1.20611 WP_000432017.1.20618 WP_000432017.1.20619 WP_000432017.1.20620 WP_000432017.1.20649 WP_000432017.1.20736 WP_000432017.1.20772 WP_000432017.1.2079 WP_000432017.1.20796 WP_000432017.1.20833 WP_000432017.1.20838 WP_000432017.1.20860 WP_000432017.1.20866 WP_000432017.1.20867 WP_000432017.1.20878 WP_000432017.1.20906 WP_000432017.1.20913 WP_000432017.1.20922 WP_000432017.1.20935 WP_000432017.1.20939 WP_000432017.1.20945 WP_000432017.1.20971 WP_000432017.1.20975 WP_000432017.1.21015 WP_000432017.1.21036 WP_000432017.1.21054 WP_000432017.1.21056 WP_000432017.1.21066 WP_000432017.1.21078 WP_000432017.1.21080 WP_000432017.1.21081 WP_000432017.1.21109 WP_000432017.1.21111 WP_000432017.1.21140 WP_000432017.1.21183 WP_000432017.1.2119 WP_000432017.1.21222 WP_000432017.1.21257 WP_000432017.1.21259 WP_000432017.1.2129 WP_000432017.1.21312 WP_000432017.1.21313 WP_000432017.1.21314 WP_000432017.1.21339 WP_000432017.1.2135 WP_000432017.1.21356 WP_000432017.1.21359 WP_000432017.1.21375 WP_000432017.1.21379 WP_000432017.1.21386 WP_000432017.1.21393 WP_000432017.1.21402 WP_000432017.1.21412 WP_000432017.1.21416 WP_000432017.1.21449 WP_000432017.1.21464 WP_000432017.1.21465 WP_000432017.1.21480 WP_000432017.1.21500 WP_000432017.1.21505 WP_000432017.1.21511 WP_000432017.1.21514 WP_000432017.1.2154 WP_000432017.1.21572 WP_000432017.1.21583 WP_000432017.1.21589 WP_000432017.1.2159 WP_000432017.1.2160 WP_000432017.1.21601 WP_000432017.1.21621 WP_000432017.1.21679 WP_000432017.1.21712 WP_000432017.1.21719 WP_000432017.1.21724 WP_000432017.1.21746 WP_000432017.1.21763 WP_000432017.1.2178 WP_000432017.1.21820 WP_000432017.1.21890 WP_000432017.1.21900 WP_000432017.1.21901 WP_000432017.1.21919 WP_000432017.1.21985 WP_000432017.1.21988 WP_000432017.1.2200 WP_000432017.1.22000 WP_000432017.1.22027 WP_000432017.1.22033 WP_000432017.1.22038 WP_000432017.1.22045 WP_000432017.1.22049 WP_000432017.1.22082 WP_000432017.1.22111 WP_000432017.1.22149 WP_000432017.1.22163 WP_000432017.1.22164 WP_000432017.1.22165 WP_000432017.1.22170 WP_000432017.1.22174 WP_000432017.1.22197 WP_000432017.1.22227 WP_000432017.1.22246 WP_000432017.1.22302 WP_000432017.1.22332 WP_000432017.1.22344 WP_000432017.1.22351 WP_000432017.1.22367 WP_000432017.1.22400 WP_000432017.1.22419 WP_000432017.1.22426 WP_000432017.1.22441 WP_000432017.1.22493 WP_000432017.1.22498 WP_000432017.1.22512 WP_000432017.1.22526 WP_000432017.1.22531 WP_000432017.1.22533 WP_000432017.1.22551 WP_000432017.1.22559 WP_000432017.1.22650 WP_000432017.1.22657 WP_000432017.1.22696 WP_000432017.1.22702 WP_000432017.1.22709 WP_000432017.1.22730 WP_000432017.1.22731 WP_000432017.1.22738 WP_000432017.1.22764 WP_000432017.1.22787 WP_000432017.1.22789 WP_000432017.1.22792 WP_000432017.1.2280 WP_000432017.1.22803 WP_000432017.1.22811 WP_000432017.1.22826 WP_000432017.1.22843 WP_000432017.1.22853 WP_000432017.1.22859 WP_000432017.1.22869 WP_000432017.1.22890 WP_000432017.1.22969 WP_000432017.1.22983 WP_000432017.1.22984 WP_000432017.1.22994 WP_000432017.1.23004 WP_000432017.1.23008 WP_000432017.1.23012 WP_000432017.1.23061 WP_000432017.1.23082 WP_000432017.1.23103 WP_000432017.1.23121 WP_000432017.1.23130 WP_000432017.1.23132 WP_000432017.1.23133 WP_000432017.1.23146 WP_000432017.1.23152 WP_000432017.1.23161 WP_000432017.1.23185 WP_000432017.1.23197 WP_000432017.1.23228 WP_000432017.1.23238 WP_000432017.1.23244 WP_000432017.1.23251 WP_000432017.1.23275 WP_000432017.1.23288 WP_000432017.1.23304 WP_000432017.1.23381 WP_000432017.1.23413 WP_000432017.1.23420 WP_000432017.1.23439 WP_000432017.1.23449 WP_000432017.1.23450 WP_000432017.1.23476 WP_000432017.1.23489 WP_000432017.1.23491 WP_000432017.1.23517 WP_000432017.1.23531 WP_000432017.1.23541 WP_000432017.1.23544 WP_000432017.1.23572 WP_000432017.1.23580 WP_000432017.1.23586 WP_000432017.1.23613 WP_000432017.1.23626 WP_000432017.1.23630 WP_000432017.1.23644 WP_000432017.1.2365 WP_000432017.1.23671 WP_000432017.1.23690 WP_000432017.1.23708 WP_000432017.1.23730 WP_000432017.1.23740 WP_000432017.1.23809 WP_000432017.1.23822 WP_000432017.1.23842 WP_000432017.1.23849 WP_000432017.1.2389 WP_000432017.1.23902 WP_000432017.1.23907 WP_000432017.1.23926 WP_000432017.1.23935 WP_000432017.1.23944 WP_000432017.1.23956 WP_000432017.1.23972 WP_000432017.1.23995 WP_000432017.1.23998 WP_000432017.1.24000 WP_000432017.1.24129 WP_000432017.1.24148 WP_000432017.1.24154 WP_000432017.1.24167 WP_000432017.1.24207 WP_000432017.1.24213 WP_000432017.1.24226 WP_000432017.1.24241 WP_000432017.1.24263 WP_000432017.1.2427 WP_000432017.1.24276 WP_000432017.1.24277 WP_000432017.1.24279 WP_000432017.1.24302 WP_000432017.1.2434 WP_000432017.1.24347 WP_000432017.1.24364 WP_000432017.1.24365 WP_000432017.1.24388 WP_000432017.1.24416 WP_000432017.1.24418 WP_000432017.1.2442 WP_000432017.1.24437 WP_000432017.1.24443 WP_000432017.1.24469 WP_000432017.1.24478 WP_000432017.1.2450 WP_000432017.1.24502 WP_000432017.1.24503 WP_000432017.1.24516 WP_000432017.1.24572 WP_000432017.1.2458 WP_000432017.1.24589 WP_000432017.1.24596 WP_000432017.1.24597 WP_000432017.1.24602 WP_000432017.1.24617 WP_000432017.1.24625 WP_000432017.1.24631 WP_000432017.1.24644 WP_000432017.1.24654 WP_000432017.1.24674 WP_000432017.1.24679 WP_000432017.1.24702 WP_000432017.1.24714 WP_000432017.1.24745 WP_000432017.1.24780 WP_000432017.1.24781 WP_000432017.1.2480 WP_000432017.1.24802 WP_000432017.1.24817 WP_000432017.1.24823 WP_000432017.1.24834 WP_000432017.1.24855 WP_000432017.1.24856 WP_000432017.1.24903 WP_000432017.1.24937 WP_000432017.1.2497 WP_000432017.1.24996 WP_000432017.1.25001 WP_000432017.1.25007 WP_000432017.1.2501 WP_000432017.1.25012 WP_000432017.1.2506 WP_000432017.1.25083 WP_000432017.1.25092 WP_000432017.1.25095 WP_000432017.1.25098 WP_000432017.1.25115 WP_000432017.1.25120 WP_000432017.1.25145 WP_000432017.1.25170 WP_000432017.1.25187 WP_000432017.1.25209 WP_000432017.1.25216 WP_000432017.1.25221 WP_000432017.1.25287 WP_000432017.1.25288 WP_000432017.1.25341 WP_000432017.1.25345 WP_000432017.1.25361 WP_000432017.1.25438 WP_000432017.1.25459 WP_000432017.1.25469 WP_000432017.1.25479 WP_000432017.1.25488 WP_000432017.1.25489 WP_000432017.1.25495 WP_000432017.1.25511 WP_000432017.1.2552 WP_000432017.1.25557 WP_000432017.1.25567 WP_000432017.1.25569 WP_000432017.1.25591 WP_000432017.1.25593 WP_000432017.1.25595 WP_000432017.1.25597 WP_000432017.1.25621 WP_000432017.1.25623 WP_000432017.1.25633 WP_000432017.1.25651 WP_000432017.1.25721 WP_000432017.1.25732 WP_000432017.1.25737 WP_000432017.1.25744 WP_000432017.1.25758 WP_000432017.1.25770 WP_000432017.1.25772 WP_000432017.1.25779 WP_000432017.1.2579 WP_000432017.1.25801 WP_000432017.1.25802 WP_000432017.1.25820 WP_000432017.1.25840 WP_000432017.1.25856 WP_000432017.1.25857 WP_000432017.1.25867 WP_000432017.1.25868 WP_000432017.1.25881 WP_000432017.1.2590 WP_000432017.1.25924 WP_000432017.1.25929 WP_000432017.1.2593 WP_000432017.1.25930 WP_000432017.1.26006 WP_000432017.1.26015 WP_000432017.1.26039 WP_000432017.1.26050 WP_000432017.1.26058 WP_000432017.1.2608 WP_000432017.1.26086 WP_000432017.1.26094 WP_000432017.1.26106 WP_000432017.1.26143 WP_000432017.1.26169 WP_000432017.1.262 WP_000432017.1.2621 WP_000432017.1.26255 WP_000432017.1.26266 WP_000432017.1.26271 WP_000432017.1.26276 WP_000432017.1.26283 WP_000432017.1.26290 WP_000432017.1.26293 WP_000432017.1.26298 WP_000432017.1.26307 WP_000432017.1.26314 WP_000432017.1.26315 WP_000432017.1.26318 WP_000432017.1.2633 WP_000432017.1.26340 WP_000432017.1.26345 WP_000432017.1.26346 WP_000432017.1.26354 WP_000432017.1.26359 WP_000432017.1.26364 WP_000432017.1.26370 WP_000432017.1.26399 WP_000432017.1.26404 WP_000432017.1.26405 WP_000432017.1.26424 WP_000432017.1.2643 WP_000432017.1.26431 WP_000432017.1.26481 WP_000432017.1.26506 WP_000432017.1.26533 WP_000432017.1.2656 WP_000432017.1.2658 WP_000432017.1.2661 WP_000432017.1.26626 WP_000432017.1.2664 WP_000432017.1.26650 WP_000432017.1.26663 WP_000432017.1.26664 WP_000432017.1.26677 WP_000432017.1.26692 WP_000432017.1.2673 WP_000432017.1.26733 WP_000432017.1.2674 WP_000432017.1.26751 WP_000432017.1.26771 WP_000432017.1.26773 WP_000432017.1.26778 WP_000432017.1.26790 WP_000432017.1.2680 WP_000432017.1.26804 WP_000432017.1.2684 WP_000432017.1.26840 WP_000432017.1.26864 WP_000432017.1.26865 WP_000432017.1.26884 WP_000432017.1.26886 WP_000432017.1.2689 WP_000432017.1.26903 WP_000432017.1.26905 WP_000432017.1.26927 WP_000432017.1.26938 WP_000432017.1.26944 WP_000432017.1.26947 WP_000432017.1.26958 WP_000432017.1.27013 WP_000432017.1.27042 WP_000432017.1.27053 WP_000432017.1.27097 WP_000432017.1.2710 WP_000432017.1.27120 WP_000432017.1.27127 WP_000432017.1.27154 WP_000432017.1.27160 WP_000432017.1.27166 WP_000432017.1.27170 WP_000432017.1.2718 WP_000432017.1.2719 WP_000432017.1.27226 WP_000432017.1.27246 WP_000432017.1.27262 WP_000432017.1.27293 WP_000432017.1.27294 WP_000432017.1.27311 WP_000432017.1.2734 WP_000432017.1.27345 WP_000432017.1.27379 WP_000432017.1.27384 WP_000432017.1.27413 WP_000432017.1.27415 WP_000432017.1.2744 WP_000432017.1.27447 WP_000432017.1.27448 WP_000432017.1.27455 WP_000432017.1.27456 WP_000432017.1.27457 WP_000432017.1.27468 WP_000432017.1.27489 WP_000432017.1.27529 WP_000432017.1.2753 WP_000432017.1.27539 WP_000432017.1.27551 WP_000432017.1.27562 WP_000432017.1.2759 WP_000432017.1.27590 WP_000432017.1.27605 WP_000432017.1.27608 WP_000432017.1.27614 WP_000432017.1.27615 WP_000432017.1.27621 WP_000432017.1.27622 WP_000432017.1.27628 WP_000432017.1.27646 WP_000432017.1.27654 WP_000432017.1.27662 WP_000432017.1.27670 WP_000432017.1.27673 WP_000432017.1.2768 WP_000432017.1.27689 WP_000432017.1.27717 WP_000432017.1.27720 WP_000432017.1.27739 WP_000432017.1.27744 WP_000432017.1.27748 WP_000432017.1.27765 WP_000432017.1.27793 WP_000432017.1.27817 WP_000432017.1.27854 WP_000432017.1.2795 WP_000432017.1.27950 WP_000432017.1.27953 WP_000432017.1.27972 WP_000432017.1.2800 WP_000432017.1.28007 WP_000432017.1.28016 WP_000432017.1.28063 WP_000432017.1.28071 WP_000432017.1.28074 WP_000432017.1.2808 WP_000432017.1.28088 WP_000432017.1.28091 WP_000432017.1.28105 WP_000432017.1.28107 WP_000432017.1.28117 WP_000432017.1.28138 WP_000432017.1.28147 WP_000432017.1.28158 WP_000432017.1.28173 WP_000432017.1.28191 WP_000432017.1.28207 WP_000432017.1.28213 WP_000432017.1.28226 WP_000432017.1.28230 WP_000432017.1.28253 WP_000432017.1.28257 WP_000432017.1.28274 WP_000432017.1.28298 WP_000432017.1.28315 WP_000432017.1.28319 WP_000432017.1.28334 WP_000432017.1.28336 WP_000432017.1.28337 WP_000432017.1.28347 WP_000432017.1.28358 WP_000432017.1.28360 WP_000432017.1.28376 WP_000432017.1.28381 WP_000432017.1.28388 WP_000432017.1.28392 WP_000432017.1.28394 WP_000432017.1.28399 WP_000432017.1.2840 WP_000432017.1.28430 WP_000432017.1.28477 WP_000432017.1.28490 WP_000432017.1.28498 WP_000432017.1.28502 WP_000432017.1.2852 WP_000432017.1.28527 WP_000432017.1.28532 WP_000432017.1.28578 WP_000432017.1.28580 WP_000432017.1.28605 WP_000432017.1.28629 WP_000432017.1.28636 WP_000432017.1.28650 WP_000432017.1.28652 WP_000432017.1.28675 WP_000432017.1.28690 WP_000432017.1.28691 WP_000432017.1.28710 WP_000432017.1.28720 WP_000432017.1.28725 WP_000432017.1.28784 WP_000432017.1.28785 WP_000432017.1.28825 WP_000432017.1.28833 WP_000432017.1.28848 WP_000432017.1.28862 WP_000432017.1.28866 WP_000432017.1.28871 WP_000432017.1.28887 WP_000432017.1.28909 WP_000432017.1.28915 WP_000432017.1.28933 WP_000432017.1.28960 WP_000432017.1.28970 WP_000432017.1.28981 WP_000432017.1.28987 WP_000432017.1.29052 WP_000432017.1.2906 WP_000432017.1.29060 WP_000432017.1.29107 WP_000432017.1.29110 WP_000432017.1.29112 WP_000432017.1.29155 WP_000432017.1.29166 WP_000432017.1.29170 WP_000432017.1.29187 WP_000432017.1.29188 WP_000432017.1.29207 WP_000432017.1.29226 WP_000432017.1.29242 WP_000432017.1.29243 WP_000432017.1.29250 WP_000432017.1.29263 WP_000432017.1.29272 WP_000432017.1.29276 WP_000432017.1.29282 WP_000432017.1.29285 WP_000432017.1.29312 WP_000432017.1.29340 WP_000432017.1.29366 WP_000432017.1.29368 WP_000432017.1.29372 WP_000432017.1.29373 WP_000432017.1.29375 WP_000432017.1.29381 WP_000432017.1.29395 WP_000432017.1.29420 WP_000432017.1.29433 WP_000432017.1.29453 WP_000432017.1.29468 WP_000432017.1.29479 WP_000432017.1.29484 WP_000432017.1.29511 WP_000432017.1.29522 WP_000432017.1.29541 WP_000432017.1.29553 WP_000432017.1.29561 WP_000432017.1.2957 WP_000432017.1.29571 WP_000432017.1.29596 WP_000432017.1.29644 WP_000432017.1.29676 WP_000432017.1.29692 WP_000432017.1.29709 WP_000432017.1.29710 WP_000432017.1.29716 WP_000432017.1.2972 WP_000432017.1.29736 WP_000432017.1.2975 WP_000432017.1.29758 WP_000432017.1.29781 WP_000432017.1.29805 WP_000432017.1.2981 WP_000432017.1.29826 WP_000432017.1.29862 WP_000432017.1.29885 WP_000432017.1.29905 WP_000432017.1.29963 WP_000432017.1.29981 WP_000432017.1.30012 WP_000432017.1.30023 WP_000432017.1.30033 WP_000432017.1.30047 WP_000432017.1.30051 WP_000432017.1.30057 WP_000432017.1.30089 WP_000432017.1.30095 WP_000432017.1.30100 WP_000432017.1.3012 WP_000432017.1.30150 WP_000432017.1.30152 WP_000432017.1.30154 WP_000432017.1.30159 WP_000432017.1.30169 WP_000432017.1.30176 WP_000432017.1.30188 WP_000432017.1.30197 WP_000432017.1.30203 WP_000432017.1.30204 WP_000432017.1.30209 WP_000432017.1.30230 WP_000432017.1.30249 WP_000432017.1.30274 WP_000432017.1.30294 WP_000432017.1.30302 WP_000432017.1.30307 WP_000432017.1.30328 WP_000432017.1.30333 WP_000432017.1.30364 WP_000432017.1.30367 WP_000432017.1.30376 WP_000432017.1.30381 WP_000432017.1.30392 WP_000432017.1.30418 WP_000432017.1.30422 WP_000432017.1.30477 WP_000432017.1.30482 WP_000432017.1.30496 WP_000432017.1.3050 WP_000432017.1.30508 WP_000432017.1.30530 WP_000432017.1.30531 WP_000432017.1.30560 WP_000432017.1.30600 WP_000432017.1.30622 WP_000432017.1.30623 WP_000432017.1.30645 WP_000432017.1.30646 WP_000432017.1.30666 WP_000432017.1.30668 WP_000432017.1.30690 WP_000432017.1.30702 WP_000432017.1.30720 WP_000432017.1.30726 WP_000432017.1.30758 WP_000432017.1.30763 WP_000432017.1.30768 WP_000432017.1.3077 WP_000432017.1.30779 WP_000432017.1.30847 WP_000432017.1.30854 WP_000432017.1.30861 WP_000432017.1.30862 WP_000432017.1.30863 WP_000432017.1.30874 WP_000432017.1.30878 WP_000432017.1.30889 WP_000432017.1.30911 WP_000432017.1.30916 WP_000432017.1.30945 WP_000432017.1.3097 WP_000432017.1.30970 WP_000432017.1.30971 WP_000432017.1.30998 WP_000432017.1.31005 WP_000432017.1.31022 WP_000432017.1.31037 WP_000432017.1.31039 WP_000432017.1.31048 WP_000432017.1.31068 WP_000432017.1.31091 WP_000432017.1.31114 WP_000432017.1.31123 WP_000432017.1.31124 WP_000432017.1.31176 WP_000432017.1.31194 WP_000432017.1.31204 WP_000432017.1.31206 WP_000432017.1.31232 WP_000432017.1.31294 WP_000432017.1.31315 WP_000432017.1.31337 WP_000432017.1.31339 WP_000432017.1.31355 WP_000432017.1.31363 WP_000432017.1.31376 WP_000432017.1.31402 WP_000432017.1.31424 WP_000432017.1.31426 WP_000432017.1.31437 WP_000432017.1.31442 WP_000432017.1.31462 WP_000432017.1.31468 WP_000432017.1.31478 WP_000432017.1.31479 WP_000432017.1.31484 WP_000432017.1.315 WP_000432017.1.31505 WP_000432017.1.31529 WP_000432017.1.31531 WP_000432017.1.31539 WP_000432017.1.31567 WP_000432017.1.31611 WP_000432017.1.31621 WP_000432017.1.31638 WP_000432017.1.31642 WP_000432017.1.31647 WP_000432017.1.31653 WP_000432017.1.31667 WP_000432017.1.31686 WP_000432017.1.31753 WP_000432017.1.31787 WP_000432017.1.31797 WP_000432017.1.31806 WP_000432017.1.31817 WP_000432017.1.31827 WP_000432017.1.31828 WP_000432017.1.31842 WP_000432017.1.31892 WP_000432017.1.31897 WP_000432017.1.31925 WP_000432017.1.31931 WP_000432017.1.31949 WP_000432017.1.31994 WP_000432017.1.31997 WP_000432017.1.32003 WP_000432017.1.32005 WP_000432017.1.32029 WP_000432017.1.32059 WP_000432017.1.32067 WP_000432017.1.32106 WP_000432017.1.32118 WP_000432017.1.32122 WP_000432017.1.32125 WP_000432017.1.32130 WP_000432017.1.32160 WP_000432017.1.32167 WP_000432017.1.3219 WP_000432017.1.32207 WP_000432017.1.32217 WP_000432017.1.32248 WP_000432017.1.32269 WP_000432017.1.32270 WP_000432017.1.32281 WP_000432017.1.3229 WP_000432017.1.32295 WP_000432017.1.32325 WP_000432017.1.32338 WP_000432017.1.32339 WP_000432017.1.32340 WP_000432017.1.32365 WP_000432017.1.32384 WP_000432017.1.32405 WP_000432017.1.3244 WP_000432017.1.32454 WP_000432017.1.32464 WP_000432017.1.32474 WP_000432017.1.32481 WP_000432017.1.32483 WP_000432017.1.32514 WP_000432017.1.32534 WP_000432017.1.32565 WP_000432017.1.32607 WP_000432017.1.32634 WP_000432017.1.32636 WP_000432017.1.32645 WP_000432017.1.32671 WP_000432017.1.32739 WP_000432017.1.32746 WP_000432017.1.32754 WP_000432017.1.32764 WP_000432017.1.32770 WP_000432017.1.32795 WP_000432017.1.328 WP_000432017.1.32800 WP_000432017.1.32839 WP_000432017.1.32898 WP_000432017.1.32921 WP_000432017.1.32925 WP_000432017.1.32928 WP_000432017.1.32939 WP_000432017.1.32954 WP_000432017.1.32980 WP_000432017.1.32987 WP_000432017.1.3299 WP_000432017.1.3301 WP_000432017.1.33038 WP_000432017.1.3306 WP_000432017.1.33108 WP_000432017.1.33110 WP_000432017.1.33123 WP_000432017.1.33147 WP_000432017.1.33161 WP_000432017.1.33199 WP_000432017.1.33212 WP_000432017.1.33213 WP_000432017.1.33250 WP_000432017.1.33252 WP_000432017.1.33255 WP_000432017.1.33266 WP_000432017.1.33277 WP_000432017.1.33296 WP_000432017.1.33307 WP_000432017.1.33335 WP_000432017.1.3335 WP_000432017.1.33350 WP_000432017.1.33368 WP_000432017.1.33372 WP_000432017.1.3338 WP_000432017.1.33388 WP_000432017.1.33394 WP_000432017.1.3341 WP_000432017.1.33416 WP_000432017.1.33432 WP_000432017.1.3345 WP_000432017.1.33463 WP_000432017.1.33468 WP_000432017.1.3347 WP_000432017.1.33483 WP_000432017.1.33484 WP_000432017.1.33507 WP_000432017.1.33516 WP_000432017.1.33518 WP_000432017.1.33520 WP_000432017.1.33540 WP_000432017.1.3357 WP_000432017.1.33575 WP_000432017.1.33594 WP_000432017.1.33626 WP_000432017.1.33627 WP_000432017.1.3363 WP_000432017.1.33650 WP_000432017.1.33654 WP_000432017.1.33692 WP_000432017.1.33695 WP_000432017.1.33718 WP_000432017.1.33720 WP_000432017.1.33724 WP_000432017.1.33735 WP_000432017.1.33737 WP_000432017.1.33743 WP_000432017.1.33765 WP_000432017.1.33766 WP_000432017.1.33769 WP_000432017.1.33792 WP_000432017.1.33804 WP_000432017.1.33813 WP_000432017.1.33816 WP_000432017.1.33855 WP_000432017.1.33899 WP_000432017.1.33915 WP_000432017.1.33940 WP_000432017.1.33949 WP_000432017.1.33963 WP_000432017.1.33966 WP_000432017.1.33968 WP_000432017.1.33971 WP_000432017.1.33983 WP_000432017.1.33994 WP_000432017.1.34026 WP_000432017.1.34030 WP_000432017.1.34051 WP_000432017.1.34079 WP_000432017.1.34080 WP_000432017.1.34100 WP_000432017.1.34105 WP_000432017.1.34112 WP_000432017.1.34132 WP_000432017.1.3418 WP_000432017.1.34182 WP_000432017.1.34194 WP_000432017.1.34209 WP_000432017.1.3422 WP_000432017.1.34223 WP_000432017.1.34231 WP_000432017.1.34244 WP_000432017.1.34250 WP_000432017.1.34280 WP_000432017.1.34285 WP_000432017.1.34307 WP_000432017.1.34334 WP_000432017.1.34361 WP_000432017.1.34381 WP_000432017.1.34403 WP_000432017.1.34410 WP_000432017.1.3442 WP_000432017.1.34436 WP_000432017.1.34438 WP_000432017.1.34471 WP_000432017.1.34482 WP_000432017.1.34492 WP_000432017.1.34502 WP_000432017.1.34510 WP_000432017.1.34512 WP_000432017.1.34526 WP_000432017.1.34569 WP_000432017.1.34578 WP_000432017.1.3461 WP_000432017.1.34626 WP_000432017.1.34666 WP_000432017.1.34677 WP_000432017.1.34716 WP_000432017.1.34723 WP_000432017.1.34737 WP_000432017.1.3474 WP_000432017.1.34741 WP_000432017.1.34767 WP_000432017.1.34818 WP_000432017.1.34865 WP_000432017.1.34877 WP_000432017.1.34890 WP_000432017.1.34923 WP_000432017.1.34926 WP_000432017.1.34967 WP_000432017.1.34998 WP_000432017.1.35014 WP_000432017.1.35031 WP_000432017.1.35032 WP_000432017.1.35059 WP_000432017.1.35089 WP_000432017.1.35097 WP_000432017.1.35106 WP_000432017.1.35108 WP_000432017.1.35110 WP_000432017.1.35121 WP_000432017.1.35177 WP_000432017.1.35189 WP_000432017.1.35222 WP_000432017.1.35257 WP_000432017.1.3526 WP_000432017.1.35264 WP_000432017.1.35276 WP_000432017.1.35285 WP_000432017.1.35289 WP_000432017.1.35297 WP_000432017.1.35314 WP_000432017.1.35334 WP_000432017.1.35340 WP_000432017.1.35342 WP_000432017.1.35345 WP_000432017.1.35352 WP_000432017.1.35391 WP_000432017.1.354 WP_000432017.1.35413 WP_000432017.1.35415 WP_000432017.1.3547 WP_000432017.1.35490 WP_000432017.1.35497 WP_000432017.1.35498 WP_000432017.1.35508 WP_000432017.1.35517 WP_000432017.1.35519 WP_000432017.1.3552 WP_000432017.1.35525 WP_000432017.1.35549 WP_000432017.1.35580 WP_000432017.1.35615 WP_000432017.1.35623 WP_000432017.1.35642 WP_000432017.1.35643 WP_000432017.1.35659 WP_000432017.1.35661 WP_000432017.1.35673 WP_000432017.1.35686 WP_000432017.1.3569 WP_000432017.1.35696 WP_000432017.1.35774 WP_000432017.1.35784 WP_000432017.1.3579 WP_000432017.1.35794 WP_000432017.1.35799 WP_000432017.1.35801 WP_000432017.1.35826 WP_000432017.1.35890 WP_000432017.1.35900 WP_000432017.1.35903 WP_000432017.1.35928 WP_000432017.1.35933 WP_000432017.1.35950 WP_000432017.1.36004 WP_000432017.1.36021 WP_000432017.1.36082 WP_000432017.1.36093 WP_000432017.1.36102 WP_000432017.1.36117 WP_000432017.1.36119 WP_000432017.1.3617 WP_000432017.1.36175 WP_000432017.1.36176 WP_000432017.1.36179 WP_000432017.1.36188 WP_000432017.1.36208 WP_000432017.1.36220 WP_000432017.1.3623 WP_000432017.1.36249 WP_000432017.1.36250 WP_000432017.1.36278 WP_000432017.1.36282 WP_000432017.1.36283 WP_000432017.1.36302 WP_000432017.1.36307 WP_000432017.1.36325 WP_000432017.1.36344 WP_000432017.1.36389 WP_000432017.1.36430 WP_000432017.1.36434 WP_000432017.1.36439 WP_000432017.1.36522 WP_000432017.1.36532 WP_000432017.1.36535 WP_000432017.1.3655 WP_000432017.1.36551 WP_000432017.1.36570 WP_000432017.1.36580 WP_000432017.1.36600 WP_000432017.1.36604 WP_000432017.1.36615 WP_000432017.1.36640 WP_000432017.1.36646 WP_000432017.1.3666 WP_000432017.1.36669 WP_000432017.1.36689 WP_000432017.1.36697 WP_000432017.1.36704 WP_000432017.1.36729 WP_000432017.1.36745 WP_000432017.1.3675 WP_000432017.1.36770 WP_000432017.1.36773 WP_000432017.1.36783 WP_000432017.1.36796 WP_000432017.1.36809 WP_000432017.1.36814 WP_000432017.1.36820 WP_000432017.1.36822 WP_000432017.1.36847 WP_000432017.1.3685 WP_000432017.1.36858 WP_000432017.1.3687 WP_000432017.1.36884 WP_000432017.1.36888 WP_000432017.1.36903 WP_000432017.1.36911 WP_000432017.1.36932 WP_000432017.1.36955 WP_000432017.1.36979 WP_000432017.1.36980 WP_000432017.1.36983 WP_000432017.1.36997 WP_000432017.1.37002 WP_000432017.1.37016 WP_000432017.1.3703 WP_000432017.1.37044 WP_000432017.1.37055 WP_000432017.1.37075 WP_000432017.1.37080 WP_000432017.1.3709 WP_000432017.1.37120 WP_000432017.1.37121 WP_000432017.1.37130 WP_000432017.1.37132 WP_000432017.1.37134 WP_000432017.1.37159 WP_000432017.1.3722 WP_000432017.1.37220 WP_000432017.1.37240 WP_000432017.1.37304 WP_000432017.1.37335 WP_000432017.1.37336 WP_000432017.1.37341 WP_000432017.1.37343 WP_000432017.1.37354 WP_000432017.1.37378 WP_000432017.1.37398 WP_000432017.1.37411 WP_000432017.1.37424 WP_000432017.1.37435 WP_000432017.1.37503 WP_000432017.1.37536 WP_000432017.1.37546 WP_000432017.1.37563 WP_000432017.1.37583 WP_000432017.1.37602 WP_000432017.1.37605 WP_000432017.1.37606 WP_000432017.1.37624 WP_000432017.1.37636 WP_000432017.1.37644 WP_000432017.1.37652 WP_000432017.1.37669 WP_000432017.1.37679 WP_000432017.1.3774 WP_000432017.1.37749 WP_000432017.1.37764 WP_000432017.1.37771 WP_000432017.1.37781 WP_000432017.1.37788 WP_000432017.1.37795 WP_000432017.1.37815 WP_000432017.1.37828 WP_000432017.1.37851 WP_000432017.1.37855 WP_000432017.1.37906 WP_000432017.1.37929 WP_000432017.1.37953 WP_000432017.1.37987 WP_000432017.1.38007 WP_000432017.1.38030 WP_000432017.1.38038 WP_000432017.1.38057 WP_000432017.1.38070 WP_000432017.1.38082 WP_000432017.1.38100 WP_000432017.1.38111 WP_000432017.1.38128 WP_000432017.1.38136 WP_000432017.1.38177 WP_000432017.1.3820 WP_000432017.1.38222 WP_000432017.1.38230 WP_000432017.1.38232 WP_000432017.1.3827 WP_000432017.1.38276 WP_000432017.1.38304 WP_000432017.1.38309 WP_000432017.1.38316 WP_000432017.1.38330 WP_000432017.1.38336 WP_000432017.1.38339 WP_000432017.1.38346 WP_000432017.1.38383 WP_000432017.1.38390 WP_000432017.1.3842 WP_000432017.1.38422 WP_000432017.1.38437 WP_000432017.1.38453 WP_000432017.1.38489 WP_000432017.1.38491 WP_000432017.1.38493 WP_000432017.1.38516 WP_000432017.1.38546 WP_000432017.1.38555 WP_000432017.1.38600 WP_000432017.1.38612 WP_000432017.1.38651 WP_000432017.1.38669 WP_000432017.1.3867 WP_000432017.1.38674 WP_000432017.1.38688 WP_000432017.1.38721 WP_000432017.1.3875 WP_000432017.1.38760 WP_000432017.1.38823 WP_000432017.1.38841 WP_000432017.1.38858 WP_000432017.1.38862 WP_000432017.1.38875 WP_000432017.1.38885 WP_000432017.1.38890 WP_000432017.1.38927 WP_000432017.1.38931 WP_000432017.1.3894 WP_000432017.1.38940 WP_000432017.1.38941 WP_000432017.1.38960 WP_000432017.1.38972 WP_000432017.1.38989 WP_000432017.1.390 WP_000432017.1.39012 WP_000432017.1.39014 WP_000432017.1.39017 WP_000432017.1.39026 WP_000432017.1.39043 WP_000432017.1.39053 WP_000432017.1.3906 WP_000432017.1.39080 WP_000432017.1.391 WP_000432017.1.39108 WP_000432017.1.39117 WP_000432017.1.39126 WP_000432017.1.39166 WP_000432017.1.39203 WP_000432017.1.39206 WP_000432017.1.39217 WP_000432017.1.3926 WP_000432017.1.39272 WP_000432017.1.39281 WP_000432017.1.39290 WP_000432017.1.39330 WP_000432017.1.39332 WP_000432017.1.39333 WP_000432017.1.39347 WP_000432017.1.39361 WP_000432017.1.39368 WP_000432017.1.39384 WP_000432017.1.39397 WP_000432017.1.39406 WP_000432017.1.39432 WP_000432017.1.39451 WP_000432017.1.39486 WP_000432017.1.39494 WP_000432017.1.39499 WP_000432017.1.39506 WP_000432017.1.39527 WP_000432017.1.39542 WP_000432017.1.39550 WP_000432017.1.39625 WP_000432017.1.39642 WP_000432017.1.39645 WP_000432017.1.39662 WP_000432017.1.39670 WP_000432017.1.39671 WP_000432017.1.39682 WP_000432017.1.39687 WP_000432017.1.39689 WP_000432017.1.39693 WP_000432017.1.39697 WP_000432017.1.39711 WP_000432017.1.39738 WP_000432017.1.39767 WP_000432017.1.39773 WP_000432017.1.39789 WP_000432017.1.39812 WP_000432017.1.39832 WP_000432017.1.39834 WP_000432017.1.39838 WP_000432017.1.39856 WP_000432017.1.39857 WP_000432017.1.39869 WP_000432017.1.39875 WP_000432017.1.39880 WP_000432017.1.39883 WP_000432017.1.39943 WP_000432017.1.39995 WP_000432017.1.40014 WP_000432017.1.40043 WP_000432017.1.40053 WP_000432017.1.4006 WP_000432017.1.40076 WP_000432017.1.40082 WP_000432017.1.40085 WP_000432017.1.40099 WP_000432017.1.4010 WP_000432017.1.40119 WP_000432017.1.4012 WP_000432017.1.40120 WP_000432017.1.40130 WP_000432017.1.40149 WP_000432017.1.4015 WP_000432017.1.40164 WP_000432017.1.40173 WP_000432017.1.4019 WP_000432017.1.40220 WP_000432017.1.40247 WP_000432017.1.4025 WP_000432017.1.40316 WP_000432017.1.40318 WP_000432017.1.40320 WP_000432017.1.40322 WP_000432017.1.40329 WP_000432017.1.40330 WP_000432017.1.40342 WP_000432017.1.40368 WP_000432017.1.40369 WP_000432017.1.40406 WP_000432017.1.40409 WP_000432017.1.40428 WP_000432017.1.40435 WP_000432017.1.40443 WP_000432017.1.40458 WP_000432017.1.40472 WP_000432017.1.40474 WP_000432017.1.40481 WP_000432017.1.40483 WP_000432017.1.40500 WP_000432017.1.40505 WP_000432017.1.40531 WP_000432017.1.40532 WP_000432017.1.4056 WP_000432017.1.40579 WP_000432017.1.40588 WP_000432017.1.40613 WP_000432017.1.40620 WP_000432017.1.40644 WP_000432017.1.40655 WP_000432017.1.40658 WP_000432017.1.40670 WP_000432017.1.40700 WP_000432017.1.40719 WP_000432017.1.40729 WP_000432017.1.40760 WP_000432017.1.4078 WP_000432017.1.40780 WP_000432017.1.40797 WP_000432017.1.40814 WP_000432017.1.40816 WP_000432017.1.40939 WP_000432017.1.40954 WP_000432017.1.40997 WP_000432017.1.41033 WP_000432017.1.41038 WP_000432017.1.4105 WP_000432017.1.41064 WP_000432017.1.41084 WP_000432017.1.41094 WP_000432017.1.41109 WP_000432017.1.41129 WP_000432017.1.4115 WP_000432017.1.41178 WP_000432017.1.412 WP_000432017.1.41208 WP_000432017.1.41238 WP_000432017.1.41241 WP_000432017.1.41245 WP_000432017.1.41255 WP_000432017.1.41288 WP_000432017.1.41289 WP_000432017.1.4129 WP_000432017.1.41314 WP_000432017.1.41341 WP_000432017.1.41350 WP_000432017.1.41374 WP_000432017.1.4138 WP_000432017.1.41386 WP_000432017.1.41389 WP_000432017.1.41426 WP_000432017.1.41432 WP_000432017.1.41433 WP_000432017.1.41444 WP_000432017.1.41456 WP_000432017.1.41461 WP_000432017.1.41499 WP_000432017.1.41555 WP_000432017.1.41558 WP_000432017.1.41567 WP_000432017.1.41581 WP_000432017.1.41582 WP_000432017.1.41587 WP_000432017.1.41598 WP_000432017.1.41599 WP_000432017.1.4160 WP_000432017.1.41612 WP_000432017.1.4162 WP_000432017.1.41620 WP_000432017.1.41623 WP_000432017.1.41674 WP_000432017.1.41681 WP_000432017.1.4169 WP_000432017.1.41698 WP_000432017.1.41743 WP_000432017.1.41755 WP_000432017.1.41796 WP_000432017.1.4182 WP_000432017.1.41821 WP_000432017.1.41839 WP_000432017.1.41863 WP_000432017.1.4188 WP_000432017.1.41898 WP_000432017.1.41906 WP_000432017.1.41935 WP_000432017.1.41943 WP_000432017.1.41954 WP_000432017.1.41983 WP_000432017.1.420 WP_000432017.1.42003 WP_000432017.1.42005 WP_000432017.1.42015 WP_000432017.1.42017 WP_000432017.1.4202 WP_000432017.1.42028 WP_000432017.1.42056 WP_000432017.1.42064 WP_000432017.1.42072 WP_000432017.1.42085 WP_000432017.1.42087 WP_000432017.1.42125 WP_000432017.1.42137 WP_000432017.1.42169 WP_000432017.1.42177 WP_000432017.1.42178 WP_000432017.1.42198 WP_000432017.1.42230 WP_000432017.1.42241 WP_000432017.1.4225 WP_000432017.1.42269 WP_000432017.1.42298 WP_000432017.1.42305 WP_000432017.1.4231 WP_000432017.1.42325 WP_000432017.1.42336 WP_000432017.1.42344 WP_000432017.1.42403 WP_000432017.1.42436 WP_000432017.1.42438 WP_000432017.1.42455 WP_000432017.1.42459 WP_000432017.1.42481 WP_000432017.1.42503 WP_000432017.1.42510 WP_000432017.1.42517 WP_000432017.1.42598 WP_000432017.1.426 WP_000432017.1.4260 WP_000432017.1.42607 WP_000432017.1.42640 WP_000432017.1.42652 WP_000432017.1.42668 WP_000432017.1.42679 WP_000432017.1.42681 WP_000432017.1.42706 WP_000432017.1.42737 WP_000432017.1.42759 WP_000432017.1.42764 WP_000432017.1.42786 WP_000432017.1.42798 WP_000432017.1.42802 WP_000432017.1.42816 WP_000432017.1.42837 WP_000432017.1.42893 WP_000432017.1.42897 WP_000432017.1.42907 WP_000432017.1.42924 WP_000432017.1.42925 WP_000432017.1.4293 WP_000432017.1.42959 WP_000432017.1.42982 WP_000432017.1.42984 WP_000432017.1.4299 WP_000432017.1.42990 WP_000432017.1.43014 WP_000432017.1.43023 WP_000432017.1.43033 WP_000432017.1.43061 WP_000432017.1.43072 WP_000432017.1.43095 WP_000432017.1.43110 WP_000432017.1.43122 WP_000432017.1.43125 WP_000432017.1.43131 WP_000432017.1.43134 WP_000432017.1.43139 WP_000432017.1.43143 WP_000432017.1.43159 WP_000432017.1.43165 WP_000432017.1.43168 WP_000432017.1.43179 WP_000432017.1.43202 WP_000432017.1.43204 WP_000432017.1.43220 WP_000432017.1.43232 WP_000432017.1.43248 WP_000432017.1.4325 WP_000432017.1.43252 WP_000432017.1.43274 WP_000432017.1.43279 WP_000432017.1.43323 WP_000432017.1.43325 WP_000432017.1.43328 WP_000432017.1.43341 WP_000432017.1.43349 WP_000432017.1.43360 WP_000432017.1.43366 WP_000432017.1.43369 WP_000432017.1.4337 WP_000432017.1.43375 WP_000432017.1.43405 WP_000432017.1.4341 WP_000432017.1.43446 WP_000432017.1.43460 WP_000432017.1.43512 WP_000432017.1.43530 WP_000432017.1.43550 WP_000432017.1.43560 WP_000432017.1.43600 WP_000432017.1.43617 WP_000432017.1.43618 WP_000432017.1.43627 WP_000432017.1.43659 WP_000432017.1.43665 WP_000432017.1.43670 WP_000432017.1.4369 WP_000432017.1.43693 WP_000432017.1.4370 WP_000432017.1.43702 WP_000432017.1.43703 WP_000432017.1.4372 WP_000432017.1.43731 WP_000432017.1.4374 WP_000432017.1.43752 WP_000432017.1.43784 WP_000432017.1.43788 WP_000432017.1.4379 WP_000432017.1.43822 WP_000432017.1.43827 WP_000432017.1.4385 WP_000432017.1.4386 WP_000432017.1.43904 WP_000432017.1.43915 WP_000432017.1.43924 WP_000432017.1.43984 WP_000432017.1.43995 WP_000432017.1.44021 WP_000432017.1.44072 WP_000432017.1.44074 WP_000432017.1.44095 WP_000432017.1.44150 WP_000432017.1.44153 WP_000432017.1.44177 WP_000432017.1.44178 WP_000432017.1.44181 WP_000432017.1.44195 WP_000432017.1.44255 WP_000432017.1.44265 WP_000432017.1.44302 WP_000432017.1.44312 WP_000432017.1.44344 WP_000432017.1.44382 WP_000432017.1.44388 WP_000432017.1.44396 WP_000432017.1.44405 WP_000432017.1.44420 WP_000432017.1.44432 WP_000432017.1.44455 WP_000432017.1.44480 WP_000432017.1.44493 WP_000432017.1.44515 WP_000432017.1.44520 WP_000432017.1.44544 WP_000432017.1.44579 WP_000432017.1.44586 WP_000432017.1.44588 WP_000432017.1.44605 WP_000432017.1.44623 WP_000432017.1.44631 WP_000432017.1.44667 WP_000432017.1.44672 WP_000432017.1.44674 WP_000432017.1.447 WP_000432017.1.44714 WP_000432017.1.44715 WP_000432017.1.44732 WP_000432017.1.44755 WP_000432017.1.44768 WP_000432017.1.44780 WP_000432017.1.44785 WP_000432017.1.44796 WP_000432017.1.44802 WP_000432017.1.44853 WP_000432017.1.44856 WP_000432017.1.44868 WP_000432017.1.44876 WP_000432017.1.44881 WP_000432017.1.44882 WP_000432017.1.44891 WP_000432017.1.44892 WP_000432017.1.44899 WP_000432017.1.44914 WP_000432017.1.44932 WP_000432017.1.44948 WP_000432017.1.44955 WP_000432017.1.44969 WP_000432017.1.44993 WP_000432017.1.45015 WP_000432017.1.45033 WP_000432017.1.45035 WP_000432017.1.45042 WP_000432017.1.45050 WP_000432017.1.45080 WP_000432017.1.45091 WP_000432017.1.45094 WP_000432017.1.45099 WP_000432017.1.45111 WP_000432017.1.45133 WP_000432017.1.45140 WP_000432017.1.45157 WP_000432017.1.45162 WP_000432017.1.45170 WP_000432017.1.45188 WP_000432017.1.452 WP_000432017.1.45223 WP_000432017.1.45242 WP_000432017.1.45267 WP_000432017.1.4527 WP_000432017.1.45272 WP_000432017.1.45281 WP_000432017.1.45290 WP_000432017.1.45297 WP_000432017.1.453 WP_000432017.1.45303 WP_000432017.1.45321 WP_000432017.1.45332 WP_000432017.1.45364 WP_000432017.1.45419 WP_000432017.1.45431 WP_000432017.1.45439 WP_000432017.1.45447 WP_000432017.1.45450 WP_000432017.1.45456 WP_000432017.1.4546 WP_000432017.1.4550 WP_000432017.1.45507 WP_000432017.1.45542 WP_000432017.1.45555 WP_000432017.1.45560 WP_000432017.1.45574 WP_000432017.1.45577 WP_000432017.1.45610 WP_000432017.1.45640 WP_000432017.1.45645 WP_000432017.1.45670 WP_000432017.1.45703 WP_000432017.1.45713 WP_000432017.1.45730 WP_000432017.1.45747 WP_000432017.1.45763 WP_000432017.1.4577 WP_000432017.1.45771 WP_000432017.1.45773 WP_000432017.1.45780 WP_000432017.1.4580 WP_000432017.1.4582 WP_000432017.1.45833 WP_000432017.1.4584 WP_000432017.1.45852 WP_000432017.1.45859 WP_000432017.1.45862 WP_000432017.1.45870 WP_000432017.1.45874 WP_000432017.1.45875 WP_000432017.1.45881 WP_000432017.1.45888 WP_000432017.1.45897 WP_000432017.1.45954 WP_000432017.1.4597 WP_000432017.1.45972 WP_000432017.1.45977 WP_000432017.1.45979 WP_000432017.1.4598 WP_000432017.1.46003 WP_000432017.1.46005 WP_000432017.1.46021 WP_000432017.1.46035 WP_000432017.1.46037 WP_000432017.1.46050 WP_000432017.1.46055 WP_000432017.1.46071 WP_000432017.1.46078 WP_000432017.1.46087 WP_000432017.1.46106 WP_000432017.1.46136 WP_000432017.1.46168 WP_000432017.1.46171 WP_000432017.1.46172 WP_000432017.1.46195 WP_000432017.1.46222 WP_000432017.1.46228 WP_000432017.1.46248 WP_000432017.1.46259 WP_000432017.1.46276 WP_000432017.1.46289 WP_000432017.1.46320 WP_000432017.1.46330 WP_000432017.1.46333 WP_000432017.1.46334 WP_000432017.1.46339 WP_000432017.1.46353 WP_000432017.1.46362 WP_000432017.1.46368 WP_000432017.1.46380 WP_000432017.1.46389 WP_000432017.1.46401 WP_000432017.1.46422 WP_000432017.1.46457 WP_000432017.1.46465 WP_000432017.1.46488 WP_000432017.1.46514 WP_000432017.1.46528 WP_000432017.1.46529 WP_000432017.1.46534 WP_000432017.1.46543 WP_000432017.1.46576 WP_000432017.1.46587 WP_000432017.1.46619 WP_000432017.1.4662 WP_000432017.1.46648 WP_000432017.1.46660 WP_000432017.1.46664 WP_000432017.1.46670 WP_000432017.1.46688 WP_000432017.1.46692 WP_000432017.1.46696 WP_000432017.1.46702 WP_000432017.1.46703 WP_000432017.1.46720 WP_000432017.1.46736 WP_000432017.1.46765 WP_000432017.1.46767 WP_000432017.1.46770 WP_000432017.1.46772 WP_000432017.1.4680 WP_000432017.1.46815 WP_000432017.1.46823 WP_000432017.1.46837 WP_000432017.1.46852 WP_000432017.1.46875 WP_000432017.1.46906 WP_000432017.1.46908 WP_000432017.1.46914 WP_000432017.1.46925 WP_000432017.1.46929 WP_000432017.1.46937 WP_000432017.1.4694 WP_000432017.1.46947 WP_000432017.1.4696 WP_000432017.1.46964 WP_000432017.1.46983 WP_000432017.1.47002 WP_000432017.1.47051 WP_000432017.1.47065 WP_000432017.1.47090 WP_000432017.1.47105 WP_000432017.1.47107 WP_000432017.1.47111 WP_000432017.1.47128 WP_000432017.1.47153 WP_000432017.1.47159 WP_000432017.1.4716 WP_000432017.1.47163 WP_000432017.1.47175 WP_000432017.1.47187 WP_000432017.1.47205 WP_000432017.1.47211 WP_000432017.1.47216 WP_000432017.1.47218 WP_000432017.1.47258 WP_000432017.1.47279 WP_000432017.1.4728 WP_000432017.1.47282 WP_000432017.1.47290 WP_000432017.1.47294 WP_000432017.1.47306 WP_000432017.1.47308 WP_000432017.1.47328 WP_000432017.1.47334 WP_000432017.1.47381 WP_000432017.1.47383 WP_000432017.1.47399 WP_000432017.1.47405 WP_000432017.1.47406 WP_000432017.1.47408 WP_000432017.1.47422 WP_000432017.1.47426 WP_000432017.1.47432 WP_000432017.1.47439 WP_000432017.1.47459 WP_000432017.1.47493 WP_000432017.1.4752 WP_000432017.1.47522 WP_000432017.1.47530 WP_000432017.1.47541 WP_000432017.1.47554 WP_000432017.1.47560 WP_000432017.1.47570 WP_000432017.1.47617 WP_000432017.1.47618 WP_000432017.1.47629 WP_000432017.1.47667 WP_000432017.1.47669 WP_000432017.1.4767 WP_000432017.1.47680 WP_000432017.1.477 WP_000432017.1.47733 WP_000432017.1.47747 WP_000432017.1.47763 WP_000432017.1.47782 WP_000432017.1.47792 WP_000432017.1.47821 WP_000432017.1.47835 WP_000432017.1.47836 WP_000432017.1.47851 WP_000432017.1.47859 WP_000432017.1.47872 WP_000432017.1.47873 WP_000432017.1.47901 WP_000432017.1.47904 WP_000432017.1.47908 WP_000432017.1.4792 WP_000432017.1.47951 WP_000432017.1.47980 WP_000432017.1.47996 WP_000432017.1.48009 WP_000432017.1.48011 WP_000432017.1.48017 WP_000432017.1.48030 WP_000432017.1.48046 WP_000432017.1.48047 WP_000432017.1.4805 WP_000432017.1.48064 WP_000432017.1.48067 WP_000432017.1.48116 WP_000432017.1.48142 WP_000432017.1.48149 WP_000432017.1.48154 WP_000432017.1.48156 WP_000432017.1.48169 WP_000432017.1.48186 WP_000432017.1.48187 WP_000432017.1.48223 WP_000432017.1.48227 WP_000432017.1.48250 WP_000432017.1.48272 WP_000432017.1.48282 WP_000432017.1.48284 WP_000432017.1.48307 WP_000432017.1.48310 WP_000432017.1.48322 WP_000432017.1.48326 WP_000432017.1.48338 WP_000432017.1.48364 WP_000432017.1.48376 WP_000432017.1.48391 WP_000432017.1.48394 WP_000432017.1.48398 WP_000432017.1.484 WP_000432017.1.4840 WP_000432017.1.48427 WP_000432017.1.48437 WP_000432017.1.48438 WP_000432017.1.48463 WP_000432017.1.48479 WP_000432017.1.48492 WP_000432017.1.4852 WP_000432017.1.48563 WP_000432017.1.48577 WP_000432017.1.48580 WP_000432017.1.48593 WP_000432017.1.48656 WP_000432017.1.48664 WP_000432017.1.48670 WP_000432017.1.4868 WP_000432017.1.48694 WP_000432017.1.48705 WP_000432017.1.48723 WP_000432017.1.48769 WP_000432017.1.48782 WP_000432017.1.48786 WP_000432017.1.48805 WP_000432017.1.48823 WP_000432017.1.48833 WP_000432017.1.48835 WP_000432017.1.48869 WP_000432017.1.48936 WP_000432017.1.48941 WP_000432017.1.48945 WP_000432017.1.48951 WP_000432017.1.48968 WP_000432017.1.48982 WP_000432017.1.48993 WP_000432017.1.48996 WP_000432017.1.4901 WP_000432017.1.49018 WP_000432017.1.4905 WP_000432017.1.49071 WP_000432017.1.49094 WP_000432017.1.49105 WP_000432017.1.49128 WP_000432017.1.49129 WP_000432017.1.49150 WP_000432017.1.49159 WP_000432017.1.4916 WP_000432017.1.49161 WP_000432017.1.49171 WP_000432017.1.4918 WP_000432017.1.49189 WP_000432017.1.49196 WP_000432017.1.49199 WP_000432017.1.4920 WP_000432017.1.49207 WP_000432017.1.4921 WP_000432017.1.49227 WP_000432017.1.4924 WP_000432017.1.49248 WP_000432017.1.49257 WP_000432017.1.49301 WP_000432017.1.49326 WP_000432017.1.49327 WP_000432017.1.49362 WP_000432017.1.49398 WP_000432017.1.49418 WP_000432017.1.49444 WP_000432017.1.4945 WP_000432017.1.49484 WP_000432017.1.4950 WP_000432017.1.49518 WP_000432017.1.49549 WP_000432017.1.49573 WP_000432017.1.49581 WP_000432017.1.49582 WP_000432017.1.496 WP_000432017.1.49605 WP_000432017.1.4962 WP_000432017.1.49643 WP_000432017.1.49658 WP_000432017.1.49669 WP_000432017.1.49671 WP_000432017.1.49672 WP_000432017.1.49690 WP_000432017.1.49707 WP_000432017.1.49728 WP_000432017.1.49730 WP_000432017.1.49732 WP_000432017.1.49742 WP_000432017.1.49745 WP_000432017.1.49757 WP_000432017.1.4980 WP_000432017.1.49800 WP_000432017.1.49819 WP_000432017.1.49825 WP_000432017.1.49860 WP_000432017.1.49863 WP_000432017.1.4987 WP_000432017.1.49871 WP_000432017.1.4989 WP_000432017.1.49894 WP_000432017.1.49907 WP_000432017.1.49917 WP_000432017.1.49918 WP_000432017.1.49935 WP_000432017.1.4994 WP_000432017.1.49943 WP_000432017.1.49951 WP_000432017.1.49982 WP_000432017.1.50023 WP_000432017.1.50028 WP_000432017.1.50038 WP_000432017.1.50061 WP_000432017.1.50064 WP_000432017.1.50071 WP_000432017.1.50076 WP_000432017.1.50117 WP_000432017.1.5013 WP_000432017.1.50138 WP_000432017.1.50145 WP_000432017.1.50175 WP_000432017.1.50178 WP_000432017.1.50192 WP_000432017.1.50212 WP_000432017.1.50217 WP_000432017.1.50219 WP_000432017.1.50261 WP_000432017.1.50291 WP_000432017.1.50313 WP_000432017.1.50314 WP_000432017.1.5035 WP_000432017.1.50356 WP_000432017.1.50367 WP_000432017.1.50369 WP_000432017.1.50388 WP_000432017.1.50424 WP_000432017.1.50430 WP_000432017.1.50440 WP_000432017.1.5045 WP_000432017.1.50464 WP_000432017.1.50525 WP_000432017.1.50527 WP_000432017.1.50536 WP_000432017.1.50543 WP_000432017.1.50555 WP_000432017.1.50556 WP_000432017.1.50558 WP_000432017.1.50568 WP_000432017.1.50578 WP_000432017.1.5059 WP_000432017.1.50594 WP_000432017.1.50595 WP_000432017.1.50647 WP_000432017.1.50660 WP_000432017.1.50699 WP_000432017.1.50711 WP_000432017.1.50732 WP_000432017.1.50740 WP_000432017.1.50742 WP_000432017.1.50745 WP_000432017.1.50748 WP_000432017.1.50768 WP_000432017.1.50799 WP_000432017.1.5080 WP_000432017.1.50817 WP_000432017.1.50820 WP_000432017.1.50829 WP_000432017.1.5087 WP_000432017.1.50884 WP_000432017.1.50896 WP_000432017.1.50937 WP_000432017.1.50958 WP_000432017.1.50962 WP_000432017.1.50974 WP_000432017.1.51015 WP_000432017.1.5109 WP_000432017.1.5110 WP_000432017.1.5111 WP_000432017.1.51130 WP_000432017.1.51152 WP_000432017.1.5117 WP_000432017.1.51194 WP_000432017.1.51209 WP_000432017.1.51220 WP_000432017.1.51226 WP_000432017.1.51236 WP_000432017.1.51245 WP_000432017.1.51271 WP_000432017.1.51277 WP_000432017.1.51282 WP_000432017.1.51295 WP_000432017.1.51306 WP_000432017.1.51310 WP_000432017.1.51326 WP_000432017.1.51346 WP_000432017.1.51376 WP_000432017.1.51377 WP_000432017.1.51393 WP_000432017.1.51403 WP_000432017.1.51418 WP_000432017.1.5145 WP_000432017.1.51454 WP_000432017.1.51456 WP_000432017.1.51469 WP_000432017.1.51492 WP_000432017.1.51496 WP_000432017.1.515 WP_000432017.1.51527 WP_000432017.1.5155 WP_000432017.1.51557 WP_000432017.1.51558 WP_000432017.1.51575 WP_000432017.1.51590 WP_000432017.1.51619 WP_000432017.1.51623 WP_000432017.1.51657 WP_000432017.1.51665 WP_000432017.1.51702 WP_000432017.1.51713 WP_000432017.1.51716 WP_000432017.1.51741 WP_000432017.1.51744 WP_000432017.1.51748 WP_000432017.1.51751 WP_000432017.1.51794 WP_000432017.1.51797 WP_000432017.1.51824 WP_000432017.1.51836 WP_000432017.1.51842 WP_000432017.1.51844 WP_000432017.1.5186 WP_000432017.1.51866 WP_000432017.1.51871 WP_000432017.1.51883 WP_000432017.1.51912 WP_000432017.1.51924 WP_000432017.1.51936 WP_000432017.1.51952 WP_000432017.1.51971 WP_000432017.1.51973 WP_000432017.1.51995 WP_000432017.1.52034 WP_000432017.1.52061 WP_000432017.1.52072 WP_000432017.1.52078 WP_000432017.1.521 WP_000432017.1.5213 WP_000432017.1.52151 WP_000432017.1.52182 WP_000432017.1.52185 WP_000432017.1.52193 WP_000432017.1.52195 WP_000432017.1.52198 WP_000432017.1.52210 WP_000432017.1.52251 WP_000432017.1.52289 WP_000432017.1.52296 WP_000432017.1.523 WP_000432017.1.52308 WP_000432017.1.5231 WP_000432017.1.52322 WP_000432017.1.52327 WP_000432017.1.52331 WP_000432017.1.52340 WP_000432017.1.52343 WP_000432017.1.52377 WP_000432017.1.52396 WP_000432017.1.52427 WP_000432017.1.52440 WP_000432017.1.52442 WP_000432017.1.52452 WP_000432017.1.52463 WP_000432017.1.52474 WP_000432017.1.5251 WP_000432017.1.52511 WP_000432017.1.52518 WP_000432017.1.52548 WP_000432017.1.52595 WP_000432017.1.52602 WP_000432017.1.52605 WP_000432017.1.52622 WP_000432017.1.52623 WP_000432017.1.52624 WP_000432017.1.52633 WP_000432017.1.52645 WP_000432017.1.52660 WP_000432017.1.52670 WP_000432017.1.52687 WP_000432017.1.52699 WP_000432017.1.52715 WP_000432017.1.52722 WP_000432017.1.52754 WP_000432017.1.52828 WP_000432017.1.52830 WP_000432017.1.52836 WP_000432017.1.52848 WP_000432017.1.52877 WP_000432017.1.52878 WP_000432017.1.52889 WP_000432017.1.52893 WP_000432017.1.52900 WP_000432017.1.52941 WP_000432017.1.52947 WP_000432017.1.52965 WP_000432017.1.52983 WP_000432017.1.52984 WP_000432017.1.52992 WP_000432017.1.53002 WP_000432017.1.53022 WP_000432017.1.5304 WP_000432017.1.53050 WP_000432017.1.53057 WP_000432017.1.53060 WP_000432017.1.53069 WP_000432017.1.53109 WP_000432017.1.53140 WP_000432017.1.53153 WP_000432017.1.53178 WP_000432017.1.53189 WP_000432017.1.5319 WP_000432017.1.53209 WP_000432017.1.53245 WP_000432017.1.53260 WP_000432017.1.53285 WP_000432017.1.53312 WP_000432017.1.53319 WP_000432017.1.53323 WP_000432017.1.5336 WP_000432017.1.53363 WP_000432017.1.53366 WP_000432017.1.53372 WP_000432017.1.53373 WP_000432017.1.53379 WP_000432017.1.53383 WP_000432017.1.53387 WP_000432017.1.53394 WP_000432017.1.53403 WP_000432017.1.53408 WP_000432017.1.53432 WP_000432017.1.53444 WP_000432017.1.53452 WP_000432017.1.53462 WP_000432017.1.53467 WP_000432017.1.5347 WP_000432017.1.53521 WP_000432017.1.53577 WP_000432017.1.5359 WP_000432017.1.53641 WP_000432017.1.53648 WP_000432017.1.53671 WP_000432017.1.53691 WP_000432017.1.53758 WP_000432017.1.53766 WP_000432017.1.53774 WP_000432017.1.53799 WP_000432017.1.5382 WP_000432017.1.53835 WP_000432017.1.53886 WP_000432017.1.53889 WP_000432017.1.53911 WP_000432017.1.53915 WP_000432017.1.53924 WP_000432017.1.53926 WP_000432017.1.53934 WP_000432017.1.53969 WP_000432017.1.53999 WP_000432017.1.5401 WP_000432017.1.54022 WP_000432017.1.54029 WP_000432017.1.54048 WP_000432017.1.54049 WP_000432017.1.54074 WP_000432017.1.54086 WP_000432017.1.54094 WP_000432017.1.54105 WP_000432017.1.54109 WP_000432017.1.54147 WP_000432017.1.54199 WP_000432017.1.54229 WP_000432017.1.54237 WP_000432017.1.54246 WP_000432017.1.54253 WP_000432017.1.54282 WP_000432017.1.54290 WP_000432017.1.54297 WP_000432017.1.54299 WP_000432017.1.54332 WP_000432017.1.54395 WP_000432017.1.544 WP_000432017.1.54404 WP_000432017.1.54413 WP_000432017.1.54426 WP_000432017.1.54438 WP_000432017.1.54471 WP_000432017.1.54479 WP_000432017.1.54485 WP_000432017.1.54491 WP_000432017.1.54503 WP_000432017.1.54510 WP_000432017.1.54518 WP_000432017.1.54539 WP_000432017.1.54551 WP_000432017.1.54554 WP_000432017.1.54572 WP_000432017.1.54574 WP_000432017.1.54637 WP_000432017.1.54675 WP_000432017.1.5469 WP_000432017.1.54733 WP_000432017.1.54744 WP_000432017.1.54745 WP_000432017.1.54753 WP_000432017.1.54819 WP_000432017.1.54826 WP_000432017.1.54830 WP_000432017.1.54851 WP_000432017.1.54878 WP_000432017.1.54895 WP_000432017.1.54929 WP_000432017.1.54931 WP_000432017.1.54955 WP_000432017.1.54967 WP_000432017.1.54990 WP_000432017.1.54995 WP_000432017.1.5500 WP_000432017.1.55004 WP_000432017.1.55058 WP_000432017.1.55082 WP_000432017.1.55084 WP_000432017.1.55095 WP_000432017.1.55139 WP_000432017.1.5518 WP_000432017.1.5519 WP_000432017.1.55192 WP_000432017.1.552 WP_000432017.1.55214 WP_000432017.1.55220 WP_000432017.1.55239 WP_000432017.1.55271 WP_000432017.1.55272 WP_000432017.1.55274 WP_000432017.1.55301 WP_000432017.1.55306 WP_000432017.1.55327 WP_000432017.1.55336 WP_000432017.1.55367 WP_000432017.1.55369 WP_000432017.1.55403 WP_000432017.1.55405 WP_000432017.1.55419 WP_000432017.1.55421 WP_000432017.1.55442 WP_000432017.1.55495 WP_000432017.1.5550 WP_000432017.1.55508 WP_000432017.1.55535 WP_000432017.1.55538 WP_000432017.1.5554 WP_000432017.1.55544 WP_000432017.1.55558 WP_000432017.1.55573 WP_000432017.1.55583 WP_000432017.1.5559 WP_000432017.1.55603 WP_000432017.1.5562 WP_000432017.1.55628 WP_000432017.1.55653 WP_000432017.1.557 WP_000432017.1.55717 WP_000432017.1.55719 WP_000432017.1.55724 WP_000432017.1.55728 WP_000432017.1.55746 WP_000432017.1.55784 WP_000432017.1.55786 WP_000432017.1.5580 WP_000432017.1.55818 WP_000432017.1.55831 WP_000432017.1.55845 WP_000432017.1.55854 WP_000432017.1.55867 WP_000432017.1.55886 WP_000432017.1.5589 WP_000432017.1.5590 WP_000432017.1.55904 WP_000432017.1.55916 WP_000432017.1.55933 WP_000432017.1.55953 WP_000432017.1.55955 WP_000432017.1.55985 WP_000432017.1.55991 WP_000432017.1.56000 WP_000432017.1.56003 WP_000432017.1.56025 WP_000432017.1.56039 WP_000432017.1.5604 WP_000432017.1.56048 WP_000432017.1.5606 WP_000432017.1.56064 WP_000432017.1.56078 WP_000432017.1.56098 WP_000432017.1.56106 WP_000432017.1.56135 WP_000432017.1.56153 WP_000432017.1.56159 WP_000432017.1.56200 WP_000432017.1.56214 WP_000432017.1.56220 WP_000432017.1.56225 WP_000432017.1.5623 WP_000432017.1.56239 WP_000432017.1.56265 WP_000432017.1.56281 WP_000432017.1.56306 WP_000432017.1.56332 WP_000432017.1.56333 WP_000432017.1.56343 WP_000432017.1.5635 WP_000432017.1.56387 WP_000432017.1.5644 WP_000432017.1.56453 WP_000432017.1.56464 WP_000432017.1.56482 WP_000432017.1.56496 WP_000432017.1.56527 WP_000432017.1.56542 WP_000432017.1.56558 WP_000432017.1.56570 WP_000432017.1.5658 WP_000432017.1.56598 WP_000432017.1.566 WP_000432017.1.56608 WP_000432017.1.56628 WP_000432017.1.56641 WP_000432017.1.5665 WP_000432017.1.56658 WP_000432017.1.5666 WP_000432017.1.56702 WP_000432017.1.56708 WP_000432017.1.56723 WP_000432017.1.56737 WP_000432017.1.5675 WP_000432017.1.5677 WP_000432017.1.56778 WP_000432017.1.56779 WP_000432017.1.56794 WP_000432017.1.56806 WP_000432017.1.56815 WP_000432017.1.56822 WP_000432017.1.56856 WP_000432017.1.56865 WP_000432017.1.569 WP_000432017.1.56903 WP_000432017.1.56931 WP_000432017.1.56966 WP_000432017.1.56967 WP_000432017.1.56975 WP_000432017.1.56986 WP_000432017.1.57015 WP_000432017.1.57047 WP_000432017.1.5705 WP_000432017.1.57073 WP_000432017.1.57081 WP_000432017.1.57097 WP_000432017.1.57102 WP_000432017.1.57109 WP_000432017.1.57115 WP_000432017.1.57141 WP_000432017.1.57170 WP_000432017.1.57175 WP_000432017.1.5718 WP_000432017.1.57190 WP_000432017.1.57214 WP_000432017.1.57223 WP_000432017.1.57265 WP_000432017.1.57309 WP_000432017.1.57316 WP_000432017.1.57330 WP_000432017.1.57338 WP_000432017.1.57370 WP_000432017.1.57376 WP_000432017.1.57427 WP_000432017.1.57445 WP_000432017.1.57448 WP_000432017.1.57481 WP_000432017.1.57507 WP_000432017.1.5752 WP_000432017.1.57593 WP_000432017.1.57594 WP_000432017.1.57614 WP_000432017.1.5763 WP_000432017.1.57650 WP_000432017.1.57665 WP_000432017.1.57682 WP_000432017.1.57692 WP_000432017.1.57693 WP_000432017.1.5770 WP_000432017.1.57701 WP_000432017.1.57718 WP_000432017.1.57720 WP_000432017.1.57723 WP_000432017.1.57727 WP_000432017.1.57730 WP_000432017.1.57734 WP_000432017.1.57745 WP_000432017.1.57754 WP_000432017.1.57761 WP_000432017.1.57770 WP_000432017.1.57783 WP_000432017.1.57808 WP_000432017.1.57819 WP_000432017.1.57837 WP_000432017.1.57840 WP_000432017.1.57844 WP_000432017.1.57861 WP_000432017.1.57883 WP_000432017.1.57888 WP_000432017.1.579 WP_000432017.1.5791 WP_000432017.1.57910 WP_000432017.1.57915 WP_000432017.1.57943 WP_000432017.1.57944 WP_000432017.1.57952 WP_000432017.1.57962 WP_000432017.1.57974 WP_000432017.1.5799 WP_000432017.1.58005 WP_000432017.1.58006 WP_000432017.1.58014 WP_000432017.1.58016 WP_000432017.1.58017 WP_000432017.1.58035 WP_000432017.1.58042 WP_000432017.1.58049 WP_000432017.1.58050 WP_000432017.1.58051 WP_000432017.1.58074 WP_000432017.1.58106 WP_000432017.1.58116 WP_000432017.1.58122 WP_000432017.1.58127 WP_000432017.1.58148 WP_000432017.1.58158 WP_000432017.1.5816 WP_000432017.1.5817 WP_000432017.1.58175 WP_000432017.1.58198 WP_000432017.1.58241 WP_000432017.1.58242 WP_000432017.1.58246 WP_000432017.1.58277 WP_000432017.1.58317 WP_000432017.1.5832 WP_000432017.1.58325 WP_000432017.1.58352 WP_000432017.1.58353 WP_000432017.1.58364 WP_000432017.1.58366 WP_000432017.1.58373 WP_000432017.1.58388 WP_000432017.1.58392 WP_000432017.1.58395 WP_000432017.1.58413 WP_000432017.1.58419 WP_000432017.1.58421 WP_000432017.1.58430 WP_000432017.1.58473 WP_000432017.1.5849 WP_000432017.1.58495 WP_000432017.1.58508 WP_000432017.1.58512 WP_000432017.1.58521 WP_000432017.1.58530 WP_000432017.1.58538 WP_000432017.1.58549 WP_000432017.1.5857 WP_000432017.1.58592 WP_000432017.1.58598 WP_000432017.1.586 WP_000432017.1.58603 WP_000432017.1.58686 WP_000432017.1.58701 WP_000432017.1.58704 WP_000432017.1.58714 WP_000432017.1.58735 WP_000432017.1.58760 WP_000432017.1.58772 WP_000432017.1.58775 WP_000432017.1.58798 WP_000432017.1.58833 WP_000432017.1.58839 WP_000432017.1.58855 WP_000432017.1.58934 WP_000432017.1.58936 WP_000432017.1.58991 WP_000432017.1.58998 WP_000432017.1.5901 WP_000432017.1.59011 WP_000432017.1.59014 WP_000432017.1.59039 WP_000432017.1.5904 WP_000432017.1.59077 WP_000432017.1.59124 WP_000432017.1.59133 WP_000432017.1.59135 WP_000432017.1.59146 WP_000432017.1.59175 WP_000432017.1.5920 WP_000432017.1.59203 WP_000432017.1.59213 WP_000432017.1.5925 WP_000432017.1.59269 WP_000432017.1.59284 WP_000432017.1.5930 WP_000432017.1.59311 WP_000432017.1.59327 WP_000432017.1.59329 WP_000432017.1.59337 WP_000432017.1.59363 WP_000432017.1.59397 WP_000432017.1.59398 WP_000432017.1.5940 WP_000432017.1.59401 WP_000432017.1.59404 WP_000432017.1.59457 WP_000432017.1.59459 WP_000432017.1.59462 WP_000432017.1.59464 WP_000432017.1.59467 WP_000432017.1.59478 WP_000432017.1.59498 WP_000432017.1.59540 WP_000432017.1.59546 WP_000432017.1.59567 WP_000432017.1.59598 WP_000432017.1.59603 WP_000432017.1.59609 WP_000432017.1.59629 WP_000432017.1.59663 WP_000432017.1.59668 WP_000432017.1.59669 WP_000432017.1.59671 WP_000432017.1.59697 WP_000432017.1.5972 WP_000432017.1.59787 WP_000432017.1.59803 WP_000432017.1.59810 WP_000432017.1.5982 WP_000432017.1.59874 WP_000432017.1.59881 WP_000432017.1.59886 WP_000432017.1.59896 WP_000432017.1.59915 WP_000432017.1.59977 WP_000432017.1.60001 WP_000432017.1.60022 WP_000432017.1.6006 WP_000432017.1.60086 WP_000432017.1.60107 WP_000432017.1.60124 WP_000432017.1.60147 WP_000432017.1.60149 WP_000432017.1.60156 WP_000432017.1.60157 WP_000432017.1.6017 WP_000432017.1.602 WP_000432017.1.60201 WP_000432017.1.60251 WP_000432017.1.60259 WP_000432017.1.60280 WP_000432017.1.60289 WP_000432017.1.60302 WP_000432017.1.60307 WP_000432017.1.6034 WP_000432017.1.60353 WP_000432017.1.60360 WP_000432017.1.60368 WP_000432017.1.60382 WP_000432017.1.60414 WP_000432017.1.60431 WP_000432017.1.60434 WP_000432017.1.6045 WP_000432017.1.60462 WP_000432017.1.60473 WP_000432017.1.60492 WP_000432017.1.60493 WP_000432017.1.60515 WP_000432017.1.60530 WP_000432017.1.60547 WP_000432017.1.60551 WP_000432017.1.60585 WP_000432017.1.60594 WP_000432017.1.60595 WP_000432017.1.60636 WP_000432017.1.60641 WP_000432017.1.60675 WP_000432017.1.60677 WP_000432017.1.60690 WP_000432017.1.60696 WP_000432017.1.60704 WP_000432017.1.60734 WP_000432017.1.60750 WP_000432017.1.60758 WP_000432017.1.60759 WP_000432017.1.60778 WP_000432017.1.60787 WP_000432017.1.60813 WP_000432017.1.60820 WP_000432017.1.60845 WP_000432017.1.6085 WP_000432017.1.60869 WP_000432017.1.60888 WP_000432017.1.60898 WP_000432017.1.60912 WP_000432017.1.60923 WP_000432017.1.60939 WP_000432017.1.60943 WP_000432017.1.60946 WP_000432017.1.60948 WP_000432017.1.60949 WP_000432017.1.60965 WP_000432017.1.60981 WP_000432017.1.60991 WP_000432017.1.61009 WP_000432017.1.61013 WP_000432017.1.61023 WP_000432017.1.61026 WP_000432017.1.61029 WP_000432017.1.61030 WP_000432017.1.61031 WP_000432017.1.61077 WP_000432017.1.61082 WP_000432017.1.61115 WP_000432017.1.61119 WP_000432017.1.61139 WP_000432017.1.61152 WP_000432017.1.61153 WP_000432017.1.6118 WP_000432017.1.61187 WP_000432017.1.61188 WP_000432017.1.61189 WP_000432017.1.6119 WP_000432017.1.61215 WP_000432017.1.61224 WP_000432017.1.6123 WP_000432017.1.61257 WP_000432017.1.61261 WP_000432017.1.61263 WP_000432017.1.61277 WP_000432017.1.61286 WP_000432017.1.61289 WP_000432017.1.61313 WP_000432017.1.61316 WP_000432017.1.61324 WP_000432017.1.61327 WP_000432017.1.61339 WP_000432017.1.6136 WP_000432017.1.61408 WP_000432017.1.61413 WP_000432017.1.61440 WP_000432017.1.61534 WP_000432017.1.61547 WP_000432017.1.61555 WP_000432017.1.61564 WP_000432017.1.61585 WP_000432017.1.61591 WP_000432017.1.61597 WP_000432017.1.61615 WP_000432017.1.61639 WP_000432017.1.61641 WP_000432017.1.6166 WP_000432017.1.6168 WP_000432017.1.61687 WP_000432017.1.6170 WP_000432017.1.61705 WP_000432017.1.61747 WP_000432017.1.61749 WP_000432017.1.61784 WP_000432017.1.61800 WP_000432017.1.61802 WP_000432017.1.61831 WP_000432017.1.61838 WP_000432017.1.61864 WP_000432017.1.6189 WP_000432017.1.61899 WP_000432017.1.61903 WP_000432017.1.61910 WP_000432017.1.61921 WP_000432017.1.61936 WP_000432017.1.61970 WP_000432017.1.61975 WP_000432017.1.62002 WP_000432017.1.6201 WP_000432017.1.62028 WP_000432017.1.62030 WP_000432017.1.62069 WP_000432017.1.62088 WP_000432017.1.62093 WP_000432017.1.62096 WP_000432017.1.62140 WP_000432017.1.62160 WP_000432017.1.62164 WP_000432017.1.62229 WP_000432017.1.62247 WP_000432017.1.62254 WP_000432017.1.62265 WP_000432017.1.62346 WP_000432017.1.62352 WP_000432017.1.62367 WP_000432017.1.62382 WP_000432017.1.62383 WP_000432017.1.62398 WP_000432017.1.62409 WP_000432017.1.62414 WP_000432017.1.62416 WP_000432017.1.62429 WP_000432017.1.62453 WP_000432017.1.62459 WP_000432017.1.62474 WP_000432017.1.62482 WP_000432017.1.62492 WP_000432017.1.62496 WP_000432017.1.6250 WP_000432017.1.62537 WP_000432017.1.62539 WP_000432017.1.62553 WP_000432017.1.62575 WP_000432017.1.62602 WP_000432017.1.62625 WP_000432017.1.62630 WP_000432017.1.62653 WP_000432017.1.62671 WP_000432017.1.62674 WP_000432017.1.6268 WP_000432017.1.62684 WP_000432017.1.62685 WP_000432017.1.62723 WP_000432017.1.62740 WP_000432017.1.62756 WP_000432017.1.62764 WP_000432017.1.62771 WP_000432017.1.62781 WP_000432017.1.62796 WP_000432017.1.62808 WP_000432017.1.62822 WP_000432017.1.62829 WP_000432017.1.62831 WP_000432017.1.62842 WP_000432017.1.62863 WP_000432017.1.62878 WP_000432017.1.62880 WP_000432017.1.62927 WP_000432017.1.62956 WP_000432017.1.62970 WP_000432017.1.62974 WP_000432017.1.6298 WP_000432017.1.62998 WP_000432017.1.63003 WP_000432017.1.63004 WP_000432017.1.63011 WP_000432017.1.63027 WP_000432017.1.63047 WP_000432017.1.63050 WP_000432017.1.63051 WP_000432017.1.63062 WP_000432017.1.63070 WP_000432017.1.63085 WP_000432017.1.631 WP_000432017.1.63120 WP_000432017.1.63132 WP_000432017.1.63139 WP_000432017.1.63140 WP_000432017.1.63142 WP_000432017.1.63143 WP_000432017.1.63162 WP_000432017.1.63182 WP_000432017.1.63190 WP_000432017.1.63195 WP_000432017.1.63220 WP_000432017.1.63228 WP_000432017.1.63244 WP_000432017.1.63266 WP_000432017.1.63273 WP_000432017.1.63279 WP_000432017.1.63280 WP_000432017.1.63289 WP_000432017.1.63296 WP_000432017.1.63304 WP_000432017.1.63307 WP_000432017.1.63313 WP_000432017.1.63319 WP_000432017.1.63322 WP_000432017.1.63324 WP_000432017.1.63333 WP_000432017.1.63335 WP_000432017.1.63337 WP_000432017.1.63341 WP_000432017.1.63364 WP_000432017.1.63365 WP_000432017.1.63383 WP_000432017.1.634 WP_000432017.1.63406 WP_000432017.1.63411 WP_000432017.1.63421 WP_000432017.1.63441 WP_000432017.1.63460 WP_000432017.1.63471 WP_000432017.1.63510 WP_000432017.1.63527 WP_000432017.1.63565 WP_000432017.1.63589 WP_000432017.1.63617 WP_000432017.1.63673 WP_000432017.1.63678 WP_000432017.1.63693 WP_000432017.1.63705 WP_000432017.1.63726 WP_000432017.1.63729 WP_000432017.1.63751 WP_000432017.1.63759 WP_000432017.1.63760 WP_000432017.1.63774 WP_000432017.1.6378 WP_000432017.1.63828 WP_000432017.1.63847 WP_000432017.1.6388 WP_000432017.1.63894 WP_000432017.1.63907 WP_000432017.1.63923 WP_000432017.1.63937 WP_000432017.1.63975 WP_000432017.1.64012 WP_000432017.1.6403 WP_000432017.1.6408 WP_000432017.1.64094 WP_000432017.1.64108 WP_000432017.1.6412 WP_000432017.1.64192 WP_000432017.1.642 WP_000432017.1.64207 WP_000432017.1.64230 WP_000432017.1.64250 WP_000432017.1.64251 WP_000432017.1.64303 WP_000432017.1.64304 WP_000432017.1.64334 WP_000432017.1.64351 WP_000432017.1.64367 WP_000432017.1.64368 WP_000432017.1.6438 WP_000432017.1.64396 WP_000432017.1.64397 WP_000432017.1.64456 WP_000432017.1.64457 WP_000432017.1.64525 WP_000432017.1.64565 WP_000432017.1.64583 WP_000432017.1.6459 WP_000432017.1.64598 WP_000432017.1.6462 WP_000432017.1.64628 WP_000432017.1.64630 WP_000432017.1.64631 WP_000432017.1.64643 WP_000432017.1.64665 WP_000432017.1.64720 WP_000432017.1.64765 WP_000432017.1.6479 WP_000432017.1.64811 WP_000432017.1.64845 WP_000432017.1.64858 WP_000432017.1.64860 WP_000432017.1.64873 WP_000432017.1.64879 WP_000432017.1.6488 WP_000432017.1.64893 WP_000432017.1.64896 WP_000432017.1.64897 WP_000432017.1.64899 WP_000432017.1.64928 WP_000432017.1.64935 WP_000432017.1.64951 WP_000432017.1.64956 WP_000432017.1.64961 WP_000432017.1.64996 WP_000432017.1.64998 WP_000432017.1.65025 WP_000432017.1.65038 WP_000432017.1.65044 WP_000432017.1.65046 WP_000432017.1.65076 WP_000432017.1.65082 WP_000432017.1.65125 WP_000432017.1.65132 WP_000432017.1.65153 WP_000432017.1.65156 WP_000432017.1.65158 WP_000432017.1.65180 WP_000432017.1.65214 WP_000432017.1.65233 WP_000432017.1.65243 WP_000432017.1.65259 WP_000432017.1.65264 WP_000432017.1.65317 WP_000432017.1.65346 WP_000432017.1.65367 WP_000432017.1.65387 WP_000432017.1.65406 WP_000432017.1.65407 WP_000432017.1.65419 WP_000432017.1.65423 WP_000432017.1.65432 WP_000432017.1.6544 WP_000432017.1.65443 WP_000432017.1.65448 WP_000432017.1.65451 WP_000432017.1.6547 WP_000432017.1.65470 WP_000432017.1.65504 WP_000432017.1.6551 WP_000432017.1.65512 WP_000432017.1.65520 WP_000432017.1.65541 WP_000432017.1.65544 WP_000432017.1.65555 WP_000432017.1.65562 WP_000432017.1.65585 WP_000432017.1.6559 WP_000432017.1.65616 WP_000432017.1.65629 WP_000432017.1.65643 WP_000432017.1.65653 WP_000432017.1.65675 WP_000432017.1.6568 WP_000432017.1.65689 WP_000432017.1.65693 WP_000432017.1.65700 WP_000432017.1.65703 WP_000432017.1.65705 WP_000432017.1.65713 WP_000432017.1.65750 WP_000432017.1.65752 WP_000432017.1.65769 WP_000432017.1.65808 WP_000432017.1.65809 WP_000432017.1.65842 WP_000432017.1.6585 WP_000432017.1.65856 WP_000432017.1.65892 WP_000432017.1.65922 WP_000432017.1.65930 WP_000432017.1.65931 WP_000432017.1.65935 WP_000432017.1.65946 WP_000432017.1.65947 WP_000432017.1.65965 WP_000432017.1.65986 WP_000432017.1.66009 WP_000432017.1.6603 WP_000432017.1.66035 WP_000432017.1.66054 WP_000432017.1.66069 WP_000432017.1.66073 WP_000432017.1.66081 WP_000432017.1.661 WP_000432017.1.6612 WP_000432017.1.66120 WP_000432017.1.66130 WP_000432017.1.66133 WP_000432017.1.66144 WP_000432017.1.66175 WP_000432017.1.66262 WP_000432017.1.66265 WP_000432017.1.66281 WP_000432017.1.66298 WP_000432017.1.66302 WP_000432017.1.6632 WP_000432017.1.66366 WP_000432017.1.66433 WP_000432017.1.66453 WP_000432017.1.66482 WP_000432017.1.66505 WP_000432017.1.66513 WP_000432017.1.66519 WP_000432017.1.66554 WP_000432017.1.66556 WP_000432017.1.66564 WP_000432017.1.66576 WP_000432017.1.66588 WP_000432017.1.66598 WP_000432017.1.66601 WP_000432017.1.66606 WP_000432017.1.66611 WP_000432017.1.66614 WP_000432017.1.6662 WP_000432017.1.66628 WP_000432017.1.66655 WP_000432017.1.66664 WP_000432017.1.66677 WP_000432017.1.66705 WP_000432017.1.66711 WP_000432017.1.66712 WP_000432017.1.6674 WP_000432017.1.66756 WP_000432017.1.66766 WP_000432017.1.66786 WP_000432017.1.66803 WP_000432017.1.66816 WP_000432017.1.6684 WP_000432017.1.6688 WP_000432017.1.66938 WP_000432017.1.66969 WP_000432017.1.66979 WP_000432017.1.66996 WP_000432017.1.6700 WP_000432017.1.67006 WP_000432017.1.67012 WP_000432017.1.67014 WP_000432017.1.67067 WP_000432017.1.67072 WP_000432017.1.67090 WP_000432017.1.67112 WP_000432017.1.67113 WP_000432017.1.67135 WP_000432017.1.67147 WP_000432017.1.67155 WP_000432017.1.67160 WP_000432017.1.67191 WP_000432017.1.67204 WP_000432017.1.67212 WP_000432017.1.6722 WP_000432017.1.67238 WP_000432017.1.67251 WP_000432017.1.67259 WP_000432017.1.6726 WP_000432017.1.67286 WP_000432017.1.67294 WP_000432017.1.67297 WP_000432017.1.67312 WP_000432017.1.67328 WP_000432017.1.67329 WP_000432017.1.67333 WP_000432017.1.67379 WP_000432017.1.67386 WP_000432017.1.6740 WP_000432017.1.67414 WP_000432017.1.67418 WP_000432017.1.67420 WP_000432017.1.67425 WP_000432017.1.67447 WP_000432017.1.67457 WP_000432017.1.67460 WP_000432017.1.67480 WP_000432017.1.67505 WP_000432017.1.67513 WP_000432017.1.67520 WP_000432017.1.67521 WP_000432017.1.67540 WP_000432017.1.67554 WP_000432017.1.67571 WP_000432017.1.67572 WP_000432017.1.67609 WP_000432017.1.67612 WP_000432017.1.67618 WP_000432017.1.67621 WP_000432017.1.67632 WP_000432017.1.67644 WP_000432017.1.67651 WP_000432017.1.67652 WP_000432017.1.67653 WP_000432017.1.67691 WP_000432017.1.67703 WP_000432017.1.67713 WP_000432017.1.67722 WP_000432017.1.67752 WP_000432017.1.67754 WP_000432017.1.67806 WP_000432017.1.67815 WP_000432017.1.67834 WP_000432017.1.6786 WP_000432017.1.67864 WP_000432017.1.67865 WP_000432017.1.67867 WP_000432017.1.67880 WP_000432017.1.67889 WP_000432017.1.67900 WP_000432017.1.67925 WP_000432017.1.67941 WP_000432017.1.67986 WP_000432017.1.67991 WP_000432017.1.68001 WP_000432017.1.68033 WP_000432017.1.68054 WP_000432017.1.68066 WP_000432017.1.68101 WP_000432017.1.68102 WP_000432017.1.6811 WP_000432017.1.68111 WP_000432017.1.68134 WP_000432017.1.68139 WP_000432017.1.68141 WP_000432017.1.68152 WP_000432017.1.68160 WP_000432017.1.68161 WP_000432017.1.68199 WP_000432017.1.68202 WP_000432017.1.68219 WP_000432017.1.68221 WP_000432017.1.68223 WP_000432017.1.6824 WP_000432017.1.68261 WP_000432017.1.68268 WP_000432017.1.68295 WP_000432017.1.68296 WP_000432017.1.68299 WP_000432017.1.6830 WP_000432017.1.68307 WP_000432017.1.6834 WP_000432017.1.68343 WP_000432017.1.68351 WP_000432017.1.68355 WP_000432017.1.68366 WP_000432017.1.68367 WP_000432017.1.6839 WP_000432017.1.68397 WP_000432017.1.68398 WP_000432017.1.68404 WP_000432017.1.68416 WP_000432017.1.68425 WP_000432017.1.68466 WP_000432017.1.68476 WP_000432017.1.68479 WP_000432017.1.68483 WP_000432017.1.68489 WP_000432017.1.68504 WP_000432017.1.68512 WP_000432017.1.68522 WP_000432017.1.68542 WP_000432017.1.68548 WP_000432017.1.68565 WP_000432017.1.68575 WP_000432017.1.686 WP_000432017.1.68636 WP_000432017.1.68650 WP_000432017.1.68681 WP_000432017.1.68683 WP_000432017.1.68699 WP_000432017.1.68703 WP_000432017.1.68716 WP_000432017.1.68728 WP_000432017.1.68737 WP_000432017.1.68741 WP_000432017.1.68743 WP_000432017.1.68775 WP_000432017.1.68813 WP_000432017.1.68831 WP_000432017.1.68854 WP_000432017.1.68864 WP_000432017.1.68875 WP_000432017.1.68878 WP_000432017.1.68883 WP_000432017.1.68917 WP_000432017.1.68943 WP_000432017.1.68944 WP_000432017.1.68987 WP_000432017.1.68988 WP_000432017.1.68998 WP_000432017.1.69012 WP_000432017.1.69045 WP_000432017.1.69071 WP_000432017.1.69078 WP_000432017.1.69089 WP_000432017.1.691 WP_000432017.1.69105 WP_000432017.1.69110 WP_000432017.1.69111 WP_000432017.1.69125 WP_000432017.1.69147 WP_000432017.1.6915 WP_000432017.1.6917 WP_000432017.1.69191 WP_000432017.1.69198 WP_000432017.1.69213 WP_000432017.1.69219 WP_000432017.1.69237 WP_000432017.1.69251 WP_000432017.1.69266 WP_000432017.1.69280 WP_000432017.1.69314 WP_000432017.1.69349 WP_000432017.1.69366 WP_000432017.1.69378 WP_000432017.1.69394 WP_000432017.1.69395 WP_000432017.1.69409 WP_000432017.1.69437 WP_000432017.1.69446 WP_000432017.1.69475 WP_000432017.1.69476 WP_000432017.1.69477 WP_000432017.1.69480 WP_000432017.1.69484 WP_000432017.1.69490 WP_000432017.1.695 WP_000432017.1.69546 WP_000432017.1.69552 WP_000432017.1.69559 WP_000432017.1.69563 WP_000432017.1.69598 WP_000432017.1.69622 WP_000432017.1.69679 WP_000432017.1.6968 WP_000432017.1.69683 WP_000432017.1.69685 WP_000432017.1.69718 WP_000432017.1.69724 WP_000432017.1.69734 WP_000432017.1.6980 WP_000432017.1.69820 WP_000432017.1.69823 WP_000432017.1.69830 WP_000432017.1.69842 WP_000432017.1.69877 WP_000432017.1.69878 WP_000432017.1.69882 WP_000432017.1.699 WP_000432017.1.69902 WP_000432017.1.69921 WP_000432017.1.69934 WP_000432017.1.69980 WP_000432017.1.69987 WP_000432017.1.69995 WP_000432017.1.70024 WP_000432017.1.70048 WP_000432017.1.70059 WP_000432017.1.70094 WP_000432017.1.70105 WP_000432017.1.7012 WP_000432017.1.70133 WP_000432017.1.70161 WP_000432017.1.70210 WP_000432017.1.70220 WP_000432017.1.70225 WP_000432017.1.70228 WP_000432017.1.7024 WP_000432017.1.70253 WP_000432017.1.70273 WP_000432017.1.70294 WP_000432017.1.703 WP_000432017.1.7030 WP_000432017.1.70311 WP_000432017.1.70313 WP_000432017.1.70334 WP_000432017.1.70338 WP_000432017.1.7034 WP_000432017.1.70344 WP_000432017.1.70349 WP_000432017.1.70361 WP_000432017.1.70389 WP_000432017.1.70413 WP_000432017.1.7043 WP_000432017.1.70438 WP_000432017.1.70441 WP_000432017.1.70448 WP_000432017.1.70451 WP_000432017.1.70459 WP_000432017.1.7046 WP_000432017.1.70462 WP_000432017.1.70487 WP_000432017.1.70495 WP_000432017.1.70527 WP_000432017.1.7053 WP_000432017.1.70546 WP_000432017.1.70554 WP_000432017.1.70558 WP_000432017.1.70564 WP_000432017.1.70572 WP_000432017.1.706 WP_000432017.1.7061 WP_000432017.1.70635 WP_000432017.1.7064 WP_000432017.1.70641 WP_000432017.1.70651 WP_000432017.1.70664 WP_000432017.1.707 WP_000432017.1.7071 WP_000432017.1.70721 WP_000432017.1.7073 WP_000432017.1.70763 WP_000432017.1.70790 WP_000432017.1.70791 WP_000432017.1.70808 WP_000432017.1.70818 WP_000432017.1.70823 WP_000432017.1.70835 WP_000432017.1.70843 WP_000432017.1.70855 WP_000432017.1.7089 WP_000432017.1.70909 WP_000432017.1.70917 WP_000432017.1.70924 WP_000432017.1.70926 WP_000432017.1.70930 WP_000432017.1.70939 WP_000432017.1.70943 WP_000432017.1.710 WP_000432017.1.71016 WP_000432017.1.71043 WP_000432017.1.7105 WP_000432017.1.71058 WP_000432017.1.71059 WP_000432017.1.71073 WP_000432017.1.7109 WP_000432017.1.711 WP_000432017.1.71130 WP_000432017.1.71143 WP_000432017.1.71180 WP_000432017.1.71182 WP_000432017.1.7119 WP_000432017.1.71196 WP_000432017.1.7120 WP_000432017.1.71208 WP_000432017.1.71231 WP_000432017.1.71256 WP_000432017.1.71257 WP_000432017.1.71267 WP_000432017.1.71295 WP_000432017.1.71298 WP_000432017.1.71313 WP_000432017.1.71316 WP_000432017.1.71325 WP_000432017.1.71332 WP_000432017.1.71345 WP_000432017.1.71351 WP_000432017.1.71359 WP_000432017.1.71416 WP_000432017.1.71431 WP_000432017.1.71463 WP_000432017.1.71466 WP_000432017.1.71467 WP_000432017.1.71475 WP_000432017.1.7150 WP_000432017.1.71519 WP_000432017.1.71521 WP_000432017.1.71529 WP_000432017.1.71543 WP_000432017.1.7158 WP_000432017.1.71590 WP_000432017.1.71596 WP_000432017.1.71602 WP_000432017.1.7161 WP_000432017.1.7164 WP_000432017.1.71644 WP_000432017.1.71662 WP_000432017.1.71676 WP_000432017.1.71707 WP_000432017.1.71715 WP_000432017.1.71721 WP_000432017.1.71737 WP_000432017.1.71739 WP_000432017.1.71741 WP_000432017.1.71772 WP_000432017.1.71780 WP_000432017.1.71788 WP_000432017.1.7179 WP_000432017.1.71859 WP_000432017.1.71861 WP_000432017.1.71863 WP_000432017.1.71877 WP_000432017.1.71888 WP_000432017.1.71892 WP_000432017.1.71899 WP_000432017.1.71910 WP_000432017.1.71925 WP_000432017.1.71949 WP_000432017.1.71978 WP_000432017.1.7198 WP_000432017.1.71989 WP_000432017.1.72002 WP_000432017.1.72018 WP_000432017.1.72026 WP_000432017.1.72031 WP_000432017.1.72035 WP_000432017.1.72085 WP_000432017.1.72089 WP_000432017.1.72099 WP_000432017.1.72102 WP_000432017.1.72112 WP_000432017.1.72148 WP_000432017.1.72169 WP_000432017.1.722 WP_000432017.1.72204 WP_000432017.1.72205 WP_000432017.1.72271 WP_000432017.1.72285 WP_000432017.1.72306 WP_000432017.1.72330 WP_000432017.1.72347 WP_000432017.1.7236 WP_000432017.1.72363 WP_000432017.1.72366 WP_000432017.1.72371 WP_000432017.1.7242 WP_000432017.1.72424 WP_000432017.1.72433 WP_000432017.1.72453 WP_000432017.1.72465 WP_000432017.1.72478 WP_000432017.1.72496 WP_000432017.1.72497 WP_000432017.1.7254 WP_000432017.1.72547 WP_000432017.1.7258 WP_000432017.1.7260 WP_000432017.1.72626 WP_000432017.1.72649 WP_000432017.1.72654 WP_000432017.1.72666 WP_000432017.1.72708 WP_000432017.1.72719 WP_000432017.1.72753 WP_000432017.1.72762 WP_000432017.1.7278 WP_000432017.1.72787 WP_000432017.1.72816 WP_000432017.1.72834 WP_000432017.1.72835 WP_000432017.1.72881 WP_000432017.1.72903 WP_000432017.1.72904 WP_000432017.1.7292 WP_000432017.1.72930 WP_000432017.1.72935 WP_000432017.1.72945 WP_000432017.1.72961 WP_000432017.1.72965 WP_000432017.1.72991 WP_000432017.1.73002 WP_000432017.1.73004 WP_000432017.1.73017 WP_000432017.1.73019 WP_000432017.1.73021 WP_000432017.1.73037 WP_000432017.1.73046 WP_000432017.1.73074 WP_000432017.1.73087 WP_000432017.1.73121 WP_000432017.1.73122 WP_000432017.1.73132 WP_000432017.1.73140 WP_000432017.1.73190 WP_000432017.1.73191 WP_000432017.1.73195 WP_000432017.1.73201 WP_000432017.1.73211 WP_000432017.1.73240 WP_000432017.1.73241 WP_000432017.1.73246 WP_000432017.1.7326 WP_000432017.1.73264 WP_000432017.1.73265 WP_000432017.1.73286 WP_000432017.1.73312 WP_000432017.1.73386 WP_000432017.1.73401 WP_000432017.1.73420 WP_000432017.1.73444 WP_000432017.1.73450 WP_000432017.1.73456 WP_000432017.1.73464 WP_000432017.1.73467 WP_000432017.1.73501 WP_000432017.1.73513 WP_000432017.1.73526 WP_000432017.1.73539 WP_000432017.1.73571 WP_000432017.1.73591 WP_000432017.1.736 WP_000432017.1.7360 WP_000432017.1.73610 WP_000432017.1.73639 WP_000432017.1.7365 WP_000432017.1.73674 WP_000432017.1.73685 WP_000432017.1.73694 WP_000432017.1.73733 WP_000432017.1.73735 WP_000432017.1.73736 WP_000432017.1.73740 WP_000432017.1.73759 WP_000432017.1.73786 WP_000432017.1.73789 WP_000432017.1.7380 WP_000432017.1.73834 WP_000432017.1.73853 WP_000432017.1.73880 WP_000432017.1.73885 WP_000432017.1.73900 WP_000432017.1.73910 WP_000432017.1.73920 WP_000432017.1.73921 WP_000432017.1.73940 WP_000432017.1.73949 WP_000432017.1.73961 WP_000432017.1.73969 WP_000432017.1.73971 WP_000432017.1.73976 WP_000432017.1.73983 WP_000432017.1.74004 WP_000432017.1.74006 WP_000432017.1.7401 WP_000432017.1.74010 WP_000432017.1.74013 WP_000432017.1.74027 WP_000432017.1.7406 WP_000432017.1.74073 WP_000432017.1.74081 WP_000432017.1.74085 WP_000432017.1.74138 WP_000432017.1.74157 WP_000432017.1.74158 WP_000432017.1.74161 WP_000432017.1.74173 WP_000432017.1.7418 WP_000432017.1.74187 WP_000432017.1.74201 WP_000432017.1.74216 WP_000432017.1.74221 WP_000432017.1.74237 WP_000432017.1.74257 WP_000432017.1.7427 WP_000432017.1.74273 WP_000432017.1.7428 WP_000432017.1.74284 WP_000432017.1.74295 WP_000432017.1.74327 WP_000432017.1.74338 WP_000432017.1.7434 WP_000432017.1.74353 WP_000432017.1.74356 WP_000432017.1.74380 WP_000432017.1.74390 WP_000432017.1.74429 WP_000432017.1.74456 WP_000432017.1.74457 WP_000432017.1.74468 WP_000432017.1.74486 WP_000432017.1.74497 WP_000432017.1.74510 WP_000432017.1.74556 WP_000432017.1.7457 WP_000432017.1.74576 WP_000432017.1.74587 WP_000432017.1.74590 WP_000432017.1.74610 WP_000432017.1.74638 WP_000432017.1.74676 WP_000432017.1.74681 WP_000432017.1.74704 WP_000432017.1.74731 WP_000432017.1.74747 WP_000432017.1.74758 WP_000432017.1.74761 WP_000432017.1.74770 WP_000432017.1.74775 WP_000432017.1.74781 WP_000432017.1.74785 WP_000432017.1.74797 WP_000432017.1.74802 WP_000432017.1.74808 WP_000432017.1.7482 WP_000432017.1.74840 WP_000432017.1.74849 WP_000432017.1.74866 WP_000432017.1.74890 WP_000432017.1.74899 WP_000432017.1.74911 WP_000432017.1.74922 WP_000432017.1.74924 WP_000432017.1.74961 WP_000432017.1.74963 WP_000432017.1.74994 WP_000432017.1.74999 WP_000432017.1.7500 WP_000432017.1.75006 WP_000432017.1.75038 WP_000432017.1.75044 WP_000432017.1.75052 WP_000432017.1.75070 WP_000432017.1.75091 WP_000432017.1.75093 WP_000432017.1.75111 WP_000432017.1.75122 WP_000432017.1.75131 WP_000432017.1.75132 WP_000432017.1.75141 WP_000432017.1.75186 WP_000432017.1.75227 WP_000432017.1.75252 WP_000432017.1.75253 WP_000432017.1.75294 WP_000432017.1.75298 WP_000432017.1.75304 WP_000432017.1.75320 WP_000432017.1.75323 WP_000432017.1.75349 WP_000432017.1.75351 WP_000432017.1.75356 WP_000432017.1.75365 WP_000432017.1.75369 WP_000432017.1.75399 WP_000432017.1.75409 WP_000432017.1.75411 WP_000432017.1.7542 WP_000432017.1.75438 WP_000432017.1.75440 WP_000432017.1.75481 WP_000432017.1.75506 WP_000432017.1.75509 WP_000432017.1.75527 WP_000432017.1.75538 WP_000432017.1.75542 WP_000432017.1.75551 WP_000432017.1.75566 WP_000432017.1.75571 WP_000432017.1.7561 WP_000432017.1.75623 WP_000432017.1.75647 WP_000432017.1.75652 WP_000432017.1.75680 WP_000432017.1.75685 WP_000432017.1.75692 WP_000432017.1.75743 WP_000432017.1.75769 WP_000432017.1.75770 WP_000432017.1.75775 WP_000432017.1.758 WP_000432017.1.75800 WP_000432017.1.75809 WP_000432017.1.7584 WP_000432017.1.75840 WP_000432017.1.75862 WP_000432017.1.75879 WP_000432017.1.75881 WP_000432017.1.75910 WP_000432017.1.75929 WP_000432017.1.75969 WP_000432017.1.76010 WP_000432017.1.76013 WP_000432017.1.76015 WP_000432017.1.7602 WP_000432017.1.76047 WP_000432017.1.76050 WP_000432017.1.76053 WP_000432017.1.76071 WP_000432017.1.76073 WP_000432017.1.76095 WP_000432017.1.76111 WP_000432017.1.76112 WP_000432017.1.76114 WP_000432017.1.76121 WP_000432017.1.76136 WP_000432017.1.76143 WP_000432017.1.76149 WP_000432017.1.76153 WP_000432017.1.76179 WP_000432017.1.76230 WP_000432017.1.76234 WP_000432017.1.7624 WP_000432017.1.7625 WP_000432017.1.76258 WP_000432017.1.76261 WP_000432017.1.7627 WP_000432017.1.76282 WP_000432017.1.76295 WP_000432017.1.76313 WP_000432017.1.76323 WP_000432017.1.76332 WP_000432017.1.76333 WP_000432017.1.76337 WP_000432017.1.76351 WP_000432017.1.7638 WP_000432017.1.76419 WP_000432017.1.76420 WP_000432017.1.76421 WP_000432017.1.76424 WP_000432017.1.76426 WP_000432017.1.76431 WP_000432017.1.76497 WP_000432017.1.76604 WP_000432017.1.76606 WP_000432017.1.76624 WP_000432017.1.76648 WP_000432017.1.76674 WP_000432017.1.76686 WP_000432017.1.76690 WP_000432017.1.76693 WP_000432017.1.76711 WP_000432017.1.7675 WP_000432017.1.76790 WP_000432017.1.76792 WP_000432017.1.76798 WP_000432017.1.768 WP_000432017.1.76803 WP_000432017.1.76816 WP_000432017.1.76820 WP_000432017.1.76825 WP_000432017.1.76829 WP_000432017.1.76839 WP_000432017.1.76845 WP_000432017.1.7686 WP_000432017.1.76867 WP_000432017.1.76872 WP_000432017.1.76876 WP_000432017.1.76897 WP_000432017.1.76921 WP_000432017.1.7694 WP_000432017.1.76944 WP_000432017.1.76952 WP_000432017.1.76998 WP_000432017.1.77027 WP_000432017.1.77031 WP_000432017.1.77041 WP_000432017.1.77043 WP_000432017.1.77050 WP_000432017.1.77060 WP_000432017.1.77062 WP_000432017.1.77069 WP_000432017.1.77072 WP_000432017.1.77112 WP_000432017.1.77137 WP_000432017.1.77145 WP_000432017.1.77158 WP_000432017.1.77176 WP_000432017.1.77187 WP_000432017.1.77190 WP_000432017.1.77203 WP_000432017.1.77229 WP_000432017.1.77259 WP_000432017.1.77297 WP_000432017.1.77298 WP_000432017.1.77305 WP_000432017.1.77331 WP_000432017.1.77346 WP_000432017.1.77354 WP_000432017.1.77359 WP_000432017.1.77388 WP_000432017.1.77446 WP_000432017.1.7745 WP_000432017.1.7746 WP_000432017.1.77485 WP_000432017.1.77489 WP_000432017.1.77498 WP_000432017.1.7752 WP_000432017.1.77520 WP_000432017.1.77527 WP_000432017.1.77532 WP_000432017.1.77533 WP_000432017.1.77572 WP_000432017.1.77603 WP_000432017.1.77606 WP_000432017.1.77650 WP_000432017.1.77674 WP_000432017.1.77733 WP_000432017.1.77735 WP_000432017.1.77738 WP_000432017.1.7774 WP_000432017.1.77743 WP_000432017.1.77745 WP_000432017.1.77791 WP_000432017.1.77805 WP_000432017.1.77818 WP_000432017.1.77822 WP_000432017.1.77827 WP_000432017.1.77832 WP_000432017.1.77848 WP_000432017.1.7785 WP_000432017.1.7786 WP_000432017.1.7787 WP_000432017.1.77882 WP_000432017.1.77893 WP_000432017.1.77896 WP_000432017.1.77908 WP_000432017.1.77915 WP_000432017.1.77922 WP_000432017.1.77930 WP_000432017.1.77952 WP_000432017.1.77957 WP_000432017.1.77986 WP_000432017.1.78002 WP_000432017.1.78038 WP_000432017.1.78050 WP_000432017.1.78054 WP_000432017.1.78067 WP_000432017.1.78082 WP_000432017.1.78091 WP_000432017.1.78093 WP_000432017.1.7810 WP_000432017.1.78116 WP_000432017.1.78126 WP_000432017.1.78164 WP_000432017.1.78179 WP_000432017.1.78185 WP_000432017.1.78194 WP_000432017.1.78207 WP_000432017.1.78208 WP_000432017.1.78210 WP_000432017.1.78252 WP_000432017.1.78254 WP_000432017.1.78257 WP_000432017.1.7827 WP_000432017.1.78304 WP_000432017.1.78311 WP_000432017.1.78330 WP_000432017.1.78332 WP_000432017.1.78335 WP_000432017.1.78365 WP_000432017.1.78371 WP_000432017.1.78404 WP_000432017.1.78436 WP_000432017.1.78458 WP_000432017.1.78470 WP_000432017.1.78478 WP_000432017.1.78489 WP_000432017.1.78494 WP_000432017.1.7850 WP_000432017.1.7853 WP_000432017.1.78550 WP_000432017.1.78558 WP_000432017.1.78573 WP_000432017.1.78582 WP_000432017.1.78585 WP_000432017.1.78592 WP_000432017.1.78596 WP_000432017.1.78604 WP_000432017.1.78625 WP_000432017.1.78633 WP_000432017.1.78653 WP_000432017.1.78662 WP_000432017.1.78667 WP_000432017.1.78685 WP_000432017.1.78728 WP_000432017.1.78736 WP_000432017.1.78758 WP_000432017.1.78763 WP_000432017.1.78803 WP_000432017.1.78816 WP_000432017.1.78819 WP_000432017.1.78841 WP_000432017.1.78872 WP_000432017.1.7888 WP_000432017.1.78934 WP_000432017.1.78937 WP_000432017.1.78946 WP_000432017.1.78983 WP_000432017.1.78991 WP_000432017.1.7900 WP_000432017.1.79006 WP_000432017.1.79037 WP_000432017.1.79038 WP_000432017.1.7905 WP_000432017.1.79051 WP_000432017.1.79085 WP_000432017.1.79110 WP_000432017.1.79114 WP_000432017.1.79131 WP_000432017.1.79132 WP_000432017.1.7914 WP_000432017.1.79143 WP_000432017.1.79170 WP_000432017.1.79178 WP_000432017.1.79192 WP_000432017.1.79197 WP_000432017.1.79208 WP_000432017.1.79227 WP_000432017.1.79244 WP_000432017.1.79270 WP_000432017.1.79275 WP_000432017.1.79285 WP_000432017.1.7930 WP_000432017.1.7931 WP_000432017.1.79320 WP_000432017.1.79322 WP_000432017.1.79332 WP_000432017.1.79367 WP_000432017.1.79374 WP_000432017.1.79378 WP_000432017.1.79402 WP_000432017.1.79407 WP_000432017.1.79408 WP_000432017.1.79461 WP_000432017.1.79473 WP_000432017.1.79476 WP_000432017.1.79487 WP_000432017.1.79539 WP_000432017.1.79543 WP_000432017.1.79552 WP_000432017.1.79554 WP_000432017.1.79556 WP_000432017.1.79566 WP_000432017.1.79581 WP_000432017.1.79626 WP_000432017.1.79627 WP_000432017.1.79638 WP_000432017.1.79662 WP_000432017.1.79672 WP_000432017.1.79706 WP_000432017.1.79731 WP_000432017.1.79763 WP_000432017.1.7981 WP_000432017.1.79810 WP_000432017.1.79815 WP_000432017.1.79822 WP_000432017.1.79831 WP_000432017.1.79834 WP_000432017.1.79837 WP_000432017.1.7989 WP_000432017.1.79896 WP_000432017.1.79904 WP_000432017.1.79911 WP_000432017.1.79919 WP_000432017.1.7992 WP_000432017.1.79949 WP_000432017.1.79961 WP_000432017.1.79971 WP_000432017.1.80000 WP_000432017.1.80009 WP_000432017.1.80013 WP_000432017.1.80029 WP_000432017.1.80032 WP_000432017.1.80034 WP_000432017.1.80042 WP_000432017.1.80079 WP_000432017.1.80086 WP_000432017.1.80109 WP_000432017.1.80119 WP_000432017.1.80120 WP_000432017.1.80122 WP_000432017.1.80127 WP_000432017.1.80146 WP_000432017.1.80147 WP_000432017.1.80159 WP_000432017.1.80178 WP_000432017.1.80184 WP_000432017.1.80210 WP_000432017.1.80244 WP_000432017.1.80274 WP_000432017.1.80287 WP_000432017.1.80290 WP_000432017.1.80297 WP_000432017.1.80303 WP_000432017.1.80308 WP_000432017.1.80316 WP_000432017.1.80318 WP_000432017.1.80345 WP_000432017.1.8035 WP_000432017.1.80358 WP_000432017.1.80361 WP_000432017.1.80378 WP_000432017.1.80389 WP_000432017.1.8040 WP_000432017.1.8043 WP_000432017.1.80430 WP_000432017.1.80434 WP_000432017.1.8045 WP_000432017.1.80472 WP_000432017.1.80482 WP_000432017.1.80521 WP_000432017.1.80582 WP_000432017.1.8065 WP_000432017.1.80653 WP_000432017.1.8066 WP_000432017.1.80687 WP_000432017.1.80745 WP_000432017.1.80761 WP_000432017.1.80763 WP_000432017.1.80781 WP_000432017.1.80786 WP_000432017.1.80793 WP_000432017.1.80801 WP_000432017.1.80828 WP_000432017.1.80833 WP_000432017.1.8084 WP_000432017.1.8085 WP_000432017.1.80855 WP_000432017.1.80872 WP_000432017.1.80899 WP_000432017.1.80962 WP_000432017.1.80979 WP_000432017.1.80980 WP_000432017.1.81010 WP_000432017.1.81022 WP_000432017.1.81049 WP_000432017.1.81052 WP_000432017.1.81064 WP_000432017.1.81085 WP_000432017.1.81092 WP_000432017.1.81095 WP_000432017.1.81114 WP_000432017.1.81132 WP_000432017.1.81157 WP_000432017.1.81171 WP_000432017.1.81172 WP_000432017.1.81176 WP_000432017.1.81184 WP_000432017.1.81214 WP_000432017.1.81228 WP_000432017.1.81232 WP_000432017.1.81234 WP_000432017.1.8125 WP_000432017.1.81288 WP_000432017.1.81290 WP_000432017.1.81344 WP_000432017.1.8135 WP_000432017.1.81379 WP_000432017.1.81384 WP_000432017.1.81385 WP_000432017.1.81389 WP_000432017.1.8142 WP_000432017.1.81436 WP_000432017.1.8144 WP_000432017.1.81464 WP_000432017.1.81467 WP_000432017.1.81508 WP_000432017.1.81522 WP_000432017.1.81549 WP_000432017.1.81572 WP_000432017.1.81574 WP_000432017.1.81599 WP_000432017.1.8160 WP_000432017.1.81604 WP_000432017.1.81610 WP_000432017.1.81619 WP_000432017.1.81631 WP_000432017.1.81637 WP_000432017.1.81645 WP_000432017.1.81651 WP_000432017.1.81734 WP_000432017.1.81740 WP_000432017.1.81758 WP_000432017.1.8176 WP_000432017.1.81767 WP_000432017.1.8180 WP_000432017.1.81800 WP_000432017.1.81810 WP_000432017.1.81812 WP_000432017.1.81831 WP_000432017.1.81837 WP_000432017.1.81838 WP_000432017.1.81847 WP_000432017.1.8185 WP_000432017.1.81861 WP_000432017.1.81870 WP_000432017.1.8188 WP_000432017.1.81897 WP_000432017.1.81903 WP_000432017.1.81904 WP_000432017.1.81906 WP_000432017.1.81919 WP_000432017.1.81940 WP_000432017.1.81944 WP_000432017.1.81955 WP_000432017.1.81969 WP_000432017.1.81990 WP_000432017.1.81996 WP_000432017.1.81999 WP_000432017.1.82009 WP_000432017.1.82015 WP_000432017.1.82026 WP_000432017.1.82053 WP_000432017.1.82058 WP_000432017.1.8206 WP_000432017.1.82100 WP_000432017.1.82103 WP_000432017.1.82121 WP_000432017.1.8213 WP_000432017.1.82161 WP_000432017.1.82167 WP_000432017.1.82174 WP_000432017.1.82184 WP_000432017.1.82219 WP_000432017.1.82247 WP_000432017.1.82253 WP_000432017.1.82259 WP_000432017.1.82278 WP_000432017.1.82281 WP_000432017.1.82301 WP_000432017.1.82321 WP_000432017.1.82340 WP_000432017.1.82349 WP_000432017.1.82354 WP_000432017.1.82358 WP_000432017.1.82368 WP_000432017.1.82406 WP_000432017.1.8244 WP_000432017.1.82447 WP_000432017.1.82458 WP_000432017.1.8246 WP_000432017.1.82468 WP_000432017.1.82472 WP_000432017.1.82525 WP_000432017.1.82535 WP_000432017.1.82548 WP_000432017.1.82558 WP_000432017.1.82612 WP_000432017.1.8266 WP_000432017.1.82665 WP_000432017.1.82678 WP_000432017.1.82709 WP_000432017.1.82724 WP_000432017.1.82760 WP_000432017.1.82768 WP_000432017.1.82796 WP_000432017.1.8280 WP_000432017.1.82802 WP_000432017.1.82835 WP_000432017.1.82855 WP_000432017.1.82862 WP_000432017.1.8289 WP_000432017.1.82916 WP_000432017.1.82930 WP_000432017.1.82931 WP_000432017.1.82941 WP_000432017.1.82976 WP_000432017.1.82984 WP_000432017.1.82997 WP_000432017.1.82999 WP_000432017.1.83011 WP_000432017.1.83013 WP_000432017.1.83046 WP_000432017.1.83050 WP_000432017.1.83053 WP_000432017.1.83054 WP_000432017.1.83066 WP_000432017.1.83078 WP_000432017.1.83086 WP_000432017.1.83103 WP_000432017.1.83152 WP_000432017.1.83153 WP_000432017.1.8318 WP_000432017.1.83185 WP_000432017.1.83193 WP_000432017.1.83203 WP_000432017.1.83243 WP_000432017.1.83291 WP_000432017.1.83314 WP_000432017.1.83316 WP_000432017.1.83352 WP_000432017.1.83359 WP_000432017.1.83372 WP_000432017.1.83405 WP_000432017.1.83416 WP_000432017.1.83417 WP_000432017.1.83418 WP_000432017.1.8346 WP_000432017.1.83467 WP_000432017.1.83472 WP_000432017.1.83475 WP_000432017.1.83476 WP_000432017.1.83479 WP_000432017.1.83484 WP_000432017.1.83517 WP_000432017.1.83520 WP_000432017.1.83541 WP_000432017.1.83553 WP_000432017.1.83592 WP_000432017.1.83593 WP_000432017.1.83624 WP_000432017.1.83626 WP_000432017.1.83645 WP_000432017.1.83646 WP_000432017.1.83652 WP_000432017.1.83653 WP_000432017.1.8366 WP_000432017.1.83676 WP_000432017.1.83714 WP_000432017.1.83720 WP_000432017.1.83728 WP_000432017.1.83750 WP_000432017.1.83756 WP_000432017.1.83758 WP_000432017.1.83763 WP_000432017.1.83769 WP_000432017.1.83778 WP_000432017.1.83788 WP_000432017.1.83797 WP_000432017.1.83804 WP_000432017.1.83825 WP_000432017.1.83844 WP_000432017.1.8385 WP_000432017.1.83852 WP_000432017.1.83864 WP_000432017.1.83865 WP_000432017.1.83868 WP_000432017.1.83881 WP_000432017.1.83886 WP_000432017.1.83902 WP_000432017.1.83905 WP_000432017.1.83917 WP_000432017.1.83919 WP_000432017.1.83925 WP_000432017.1.83928 WP_000432017.1.83935 WP_000432017.1.83955 WP_000432017.1.83980 WP_000432017.1.83984 WP_000432017.1.83989 WP_000432017.1.84010 WP_000432017.1.84025 WP_000432017.1.84041 WP_000432017.1.84054 WP_000432017.1.84067 WP_000432017.1.84068 WP_000432017.1.84118 WP_000432017.1.84129 WP_000432017.1.84161 WP_000432017.1.84188 WP_000432017.1.84275 WP_000432017.1.84284 WP_000432017.1.84293 WP_000432017.1.84322 WP_000432017.1.84414 WP_000432017.1.84415 WP_000432017.1.84416 WP_000432017.1.84418 WP_000432017.1.84445 WP_000432017.1.84451 WP_000432017.1.84555 WP_000432017.1.84563 WP_000432017.1.84570 WP_000432017.1.84578 WP_000432017.1.84596 WP_000432017.1.84602 WP_000432017.1.84608 WP_000432017.1.84612 WP_000432017.1.8462 WP_000432017.1.84625 WP_000432017.1.84630 WP_000432017.1.84638 WP_000432017.1.84648 WP_000432017.1.84651 WP_000432017.1.84652 WP_000432017.1.84662 WP_000432017.1.8468 WP_000432017.1.84682 WP_000432017.1.84696 WP_000432017.1.84700 WP_000432017.1.8475 WP_000432017.1.84752 WP_000432017.1.84757 WP_000432017.1.84761 WP_000432017.1.84770 WP_000432017.1.84815 WP_000432017.1.84826 WP_000432017.1.84847 WP_000432017.1.84889 WP_000432017.1.84903 WP_000432017.1.84907 WP_000432017.1.84922 WP_000432017.1.84924 WP_000432017.1.8493 WP_000432017.1.8496 WP_000432017.1.84975 WP_000432017.1.84978 WP_000432017.1.85017 WP_000432017.1.85022 WP_000432017.1.85026 WP_000432017.1.85047 WP_000432017.1.85056 WP_000432017.1.85070 WP_000432017.1.85099 WP_000432017.1.851 WP_000432017.1.85118 WP_000432017.1.85135 WP_000432017.1.85144 WP_000432017.1.85160 WP_000432017.1.85173 WP_000432017.1.85213 WP_000432017.1.85224 WP_000432017.1.85226 WP_000432017.1.85229 WP_000432017.1.85231 WP_000432017.1.85238 WP_000432017.1.85289 WP_000432017.1.85292 WP_000432017.1.85294 WP_000432017.1.85297 WP_000432017.1.85375 WP_000432017.1.85376 WP_000432017.1.85383 WP_000432017.1.85395 WP_000432017.1.85404 WP_000432017.1.85409 WP_000432017.1.85441 WP_000432017.1.85445 WP_000432017.1.85455 WP_000432017.1.85471 WP_000432017.1.85474 WP_000432017.1.85485 WP_000432017.1.85506 WP_000432017.1.8551 WP_000432017.1.85519 WP_000432017.1.85542 WP_000432017.1.85547 WP_000432017.1.85555 WP_000432017.1.85585 WP_000432017.1.85586 WP_000432017.1.85596 WP_000432017.1.85607 WP_000432017.1.85611 WP_000432017.1.85649 WP_000432017.1.85678 WP_000432017.1.85705 WP_000432017.1.85730 WP_000432017.1.85732 WP_000432017.1.85758 WP_000432017.1.85795 WP_000432017.1.85796 WP_000432017.1.85809 WP_000432017.1.85825 WP_000432017.1.85834 WP_000432017.1.85844 WP_000432017.1.85858 WP_000432017.1.85906 WP_000432017.1.85924 WP_000432017.1.85927 WP_000432017.1.85950 WP_000432017.1.85971 WP_000432017.1.85980 WP_000432017.1.85989 WP_000432017.1.85993 WP_000432017.1.86018 WP_000432017.1.86036 WP_000432017.1.86042 WP_000432017.1.86072 WP_000432017.1.86101 WP_000432017.1.86106 WP_000432017.1.86123 WP_000432017.1.86144 WP_000432017.1.86158 WP_000432017.1.86178 WP_000432017.1.86188 WP_000432017.1.862 WP_000432017.1.86207 WP_000432017.1.86209 WP_000432017.1.86241 WP_000432017.1.86248 WP_000432017.1.86256 WP_000432017.1.8627 WP_000432017.1.86270 WP_000432017.1.86281 WP_000432017.1.86304 WP_000432017.1.86315 WP_000432017.1.86344 WP_000432017.1.8636 WP_000432017.1.86363 WP_000432017.1.86367 WP_000432017.1.86378 WP_000432017.1.86390 WP_000432017.1.8643 WP_000432017.1.86439 WP_000432017.1.86473 WP_000432017.1.86482 WP_000432017.1.86505 WP_000432017.1.86523 WP_000432017.1.86531 WP_000432017.1.86542 WP_000432017.1.86606 WP_000432017.1.86628 WP_000432017.1.86629 WP_000432017.1.86664 WP_000432017.1.86704 WP_000432017.1.86706 WP_000432017.1.86736 WP_000432017.1.86745 WP_000432017.1.86754 WP_000432017.1.86779 WP_000432017.1.86792 WP_000432017.1.86793 WP_000432017.1.86795 WP_000432017.1.8681 WP_000432017.1.86838 WP_000432017.1.86881 WP_000432017.1.8690 WP_000432017.1.86911 WP_000432017.1.86940 WP_000432017.1.86955 WP_000432017.1.86961 WP_000432017.1.86968 WP_000432017.1.86977 WP_000432017.1.8699 WP_000432017.1.86999 WP_000432017.1.87021 WP_000432017.1.87022 WP_000432017.1.87042 WP_000432017.1.87057 WP_000432017.1.87072 WP_000432017.1.87088 WP_000432017.1.87090 WP_000432017.1.87096 WP_000432017.1.87097 WP_000432017.1.87110 WP_000432017.1.87119 WP_000432017.1.87122 WP_000432017.1.87133 WP_000432017.1.87137 WP_000432017.1.87141 WP_000432017.1.87168 WP_000432017.1.87175 WP_000432017.1.87190 WP_000432017.1.87194 WP_000432017.1.8720 WP_000432017.1.87221 WP_000432017.1.87250 WP_000432017.1.87261 WP_000432017.1.87263 WP_000432017.1.87272 WP_000432017.1.87285 WP_000432017.1.87290 WP_000432017.1.87296 WP_000432017.1.8731 WP_000432017.1.87363 WP_000432017.1.87372 WP_000432017.1.87378 WP_000432017.1.87388 WP_000432017.1.87391 WP_000432017.1.87396 WP_000432017.1.87397 WP_000432017.1.87425 WP_000432017.1.87434 WP_000432017.1.87457 WP_000432017.1.87461 WP_000432017.1.87466 WP_000432017.1.87475 WP_000432017.1.87486 WP_000432017.1.87497 WP_000432017.1.87498 WP_000432017.1.875 WP_000432017.1.87502 WP_000432017.1.87508 WP_000432017.1.87511 WP_000432017.1.87515 WP_000432017.1.87543 WP_000432017.1.8757 WP_000432017.1.87579 WP_000432017.1.87595 WP_000432017.1.87623 WP_000432017.1.8764 WP_000432017.1.87647 WP_000432017.1.87710 WP_000432017.1.87734 WP_000432017.1.87735 WP_000432017.1.87740 WP_000432017.1.87745 WP_000432017.1.87748 WP_000432017.1.87764 WP_000432017.1.8779 WP_000432017.1.87802 WP_000432017.1.87808 WP_000432017.1.87828 WP_000432017.1.87838 WP_000432017.1.87841 WP_000432017.1.87865 WP_000432017.1.87879 WP_000432017.1.8791 WP_000432017.1.87943 WP_000432017.1.87964 WP_000432017.1.87967 WP_000432017.1.87985 WP_000432017.1.87995 WP_000432017.1.88032 WP_000432017.1.88061 WP_000432017.1.88101 WP_000432017.1.88114 WP_000432017.1.88150 WP_000432017.1.88166 WP_000432017.1.88169 WP_000432017.1.8820 WP_000432017.1.88270 WP_000432017.1.88279 WP_000432017.1.88309 WP_000432017.1.88311 WP_000432017.1.88317 WP_000432017.1.88319 WP_000432017.1.88328 WP_000432017.1.88348 WP_000432017.1.88351 WP_000432017.1.88367 WP_000432017.1.88375 WP_000432017.1.88380 WP_000432017.1.88395 WP_000432017.1.88418 WP_000432017.1.88430 WP_000432017.1.88449 WP_000432017.1.88455 WP_000432017.1.8847 WP_000432017.1.88471 WP_000432017.1.88473 WP_000432017.1.88478 WP_000432017.1.88480 WP_000432017.1.88498 WP_000432017.1.88518 WP_000432017.1.88555 WP_000432017.1.88563 WP_000432017.1.8857 WP_000432017.1.88580 WP_000432017.1.88585 WP_000432017.1.8859 WP_000432017.1.88599 WP_000432017.1.88600 WP_000432017.1.88614 WP_000432017.1.88623 WP_000432017.1.88636 WP_000432017.1.88642 WP_000432017.1.88671 WP_000432017.1.88694 WP_000432017.1.88696 WP_000432017.1.8872 WP_000432017.1.88738 WP_000432017.1.88739 WP_000432017.1.88753 WP_000432017.1.88761 WP_000432017.1.88771 WP_000432017.1.88781 WP_000432017.1.88805 WP_000432017.1.88827 WP_000432017.1.88843 WP_000432017.1.88856 WP_000432017.1.88859 WP_000432017.1.8886 WP_000432017.1.88861 WP_000432017.1.88871 WP_000432017.1.88874 WP_000432017.1.88878 WP_000432017.1.8888 WP_000432017.1.88897 WP_000432017.1.88912 WP_000432017.1.88922 WP_000432017.1.88934 WP_000432017.1.88954 WP_000432017.1.88959 WP_000432017.1.88960 WP_000432017.1.88962 WP_000432017.1.88987 WP_000432017.1.89012 WP_000432017.1.89036 WP_000432017.1.89086 WP_000432017.1.89125 WP_000432017.1.8913 WP_000432017.1.89133 WP_000432017.1.89164 WP_000432017.1.89173 WP_000432017.1.8918 WP_000432017.1.89181 WP_000432017.1.89184 WP_000432017.1.89194 WP_000432017.1.89195 WP_000432017.1.89204 WP_000432017.1.89229 WP_000432017.1.89237 WP_000432017.1.8924 WP_000432017.1.89284 WP_000432017.1.89290 WP_000432017.1.89347 WP_000432017.1.89348 WP_000432017.1.89350 WP_000432017.1.89390 WP_000432017.1.89404 WP_000432017.1.89414 WP_000432017.1.89433 WP_000432017.1.89439 WP_000432017.1.89516 WP_000432017.1.8953 WP_000432017.1.89537 WP_000432017.1.89544 WP_000432017.1.89545 WP_000432017.1.89559 WP_000432017.1.89628 WP_000432017.1.89651 WP_000432017.1.89655 WP_000432017.1.89672 WP_000432017.1.89678 WP_000432017.1.897 WP_000432017.1.89715 WP_000432017.1.89726 WP_000432017.1.89730 WP_000432017.1.89754 WP_000432017.1.89779 WP_000432017.1.89794 WP_000432017.1.898 WP_000432017.1.89857 WP_000432017.1.8986 WP_000432017.1.89860 WP_000432017.1.89863 WP_000432017.1.89874 WP_000432017.1.89883 WP_000432017.1.8990 WP_000432017.1.89908 WP_000432017.1.89935 WP_000432017.1.89949 WP_000432017.1.89950 WP_000432017.1.89960 WP_000432017.1.90005 WP_000432017.1.90018 WP_000432017.1.90038 WP_000432017.1.90046 WP_000432017.1.90055 WP_000432017.1.90069 WP_000432017.1.90091 WP_000432017.1.90131 WP_000432017.1.90148 WP_000432017.1.90161 WP_000432017.1.90173 WP_000432017.1.90174 WP_000432017.1.90180 WP_000432017.1.90215 WP_000432017.1.90217 WP_000432017.1.9022 WP_000432017.1.90239 WP_000432017.1.90243 WP_000432017.1.90244 WP_000432017.1.90246 WP_000432017.1.90250 WP_000432017.1.90253 WP_000432017.1.90269 WP_000432017.1.90276 WP_000432017.1.9030 WP_000432017.1.90331 WP_000432017.1.90367 WP_000432017.1.90386 WP_000432017.1.90447 WP_000432017.1.90454 WP_000432017.1.90473 WP_000432017.1.90475 WP_000432017.1.90488 WP_000432017.1.90506 WP_000432017.1.90514 WP_000432017.1.90533 WP_000432017.1.90544 WP_000432017.1.90548 WP_000432017.1.9055 WP_000432017.1.90554 WP_000432017.1.90556 WP_000432017.1.90562 WP_000432017.1.90604 WP_000432017.1.90647 WP_000432017.1.90660 WP_000432017.1.90661 WP_000432017.1.90683 WP_000432017.1.90698 WP_000432017.1.9071 WP_000432017.1.90726 WP_000432017.1.90728 WP_000432017.1.90738 WP_000432017.1.9074 WP_000432017.1.90745 WP_000432017.1.9076 WP_000432017.1.90777 WP_000432017.1.90801 WP_000432017.1.90804 WP_000432017.1.90861 WP_000432017.1.90875 WP_000432017.1.90887 WP_000432017.1.90896 WP_000432017.1.90903 WP_000432017.1.90923 WP_000432017.1.90928 WP_000432017.1.90994 WP_000432017.1.9100 WP_000432017.1.91005 WP_000432017.1.91011 WP_000432017.1.91019 WP_000432017.1.91089 WP_000432017.1.91126 WP_000432017.1.9114 WP_000432017.1.91150 WP_000432017.1.91158 WP_000432017.1.91177 WP_000432017.1.91184 WP_000432017.1.912 WP_000432017.1.9122 WP_000432017.1.91246 WP_000432017.1.91258 WP_000432017.1.9127 WP_000432017.1.91279 WP_000432017.1.91280 WP_000432017.1.91287 WP_000432017.1.9130 WP_000432017.1.91310 WP_000432017.1.91316 WP_000432017.1.91332 WP_000432017.1.91346 WP_000432017.1.91357 WP_000432017.1.91364 WP_000432017.1.91371 WP_000432017.1.91380 WP_000432017.1.91382 WP_000432017.1.9140 WP_000432017.1.91420 WP_000432017.1.91427 WP_000432017.1.91447 WP_000432017.1.91465 WP_000432017.1.91486 WP_000432017.1.91487 WP_000432017.1.91500 WP_000432017.1.91501 WP_000432017.1.91525 WP_000432017.1.91530 WP_000432017.1.91542 WP_000432017.1.91547 WP_000432017.1.9155 WP_000432017.1.91559 WP_000432017.1.91573 WP_000432017.1.91581 WP_000432017.1.91586 WP_000432017.1.91587 WP_000432017.1.91591 WP_000432017.1.91611 WP_000432017.1.91629 WP_000432017.1.91634 WP_000432017.1.91635 WP_000432017.1.91639 WP_000432017.1.91670 WP_000432017.1.917 WP_000432017.1.91704 WP_000432017.1.91745 WP_000432017.1.91749 WP_000432017.1.91771 WP_000432017.1.91781 WP_000432017.1.91791 WP_000432017.1.91816 WP_000432017.1.91829 WP_000432017.1.91848 WP_000432017.1.91895 WP_000432017.1.91911 WP_000432017.1.91918 WP_000432017.1.91928 WP_000432017.1.91950 WP_000432017.1.91955 WP_000432017.1.91969 WP_000432017.1.92055 WP_000432017.1.92057 WP_000432017.1.92080 WP_000432017.1.92104 WP_000432017.1.92110 WP_000432017.1.92115 WP_000432017.1.92125 WP_000432017.1.92133 WP_000432017.1.92140 WP_000432017.1.92158 WP_000432017.1.92164 WP_000432017.1.92169 WP_000432017.1.92185 WP_000432017.1.92186 WP_000432017.1.92196 WP_000432017.1.92212 WP_000432017.1.92218 WP_000432017.1.92227 WP_000432017.1.92228 WP_000432017.1.9224 WP_000432017.1.92244 WP_000432017.1.92249 WP_000432017.1.92253 WP_000432017.1.92254 WP_000432017.1.92259 WP_000432017.1.92278 WP_000432017.1.923 WP_000432017.1.92303 WP_000432017.1.92324 WP_000432017.1.9234 WP_000432017.1.92391 WP_000432017.1.92405 WP_000432017.1.92424 WP_000432017.1.92425 WP_000432017.1.92436 WP_000432017.1.92442 WP_000432017.1.9247 WP_000432017.1.92497 WP_000432017.1.92500 WP_000432017.1.92512 WP_000432017.1.92520 WP_000432017.1.92534 WP_000432017.1.92560 WP_000432017.1.92565 WP_000432017.1.92607 WP_000432017.1.92674 WP_000432017.1.92691 WP_000432017.1.92718 WP_000432017.1.92723 WP_000432017.1.92726 WP_000432017.1.92735 WP_000432017.1.92741 WP_000432017.1.92765 WP_000432017.1.92772 WP_000432017.1.92773 WP_000432017.1.92789 WP_000432017.1.92795 WP_000432017.1.92840 WP_000432017.1.92849 WP_000432017.1.9286 WP_000432017.1.92862 WP_000432017.1.92864 WP_000432017.1.92897 WP_000432017.1.92918 WP_000432017.1.9293 WP_000432017.1.92950 WP_000432017.1.9296 WP_000432017.1.92960 WP_000432017.1.92965 WP_000432017.1.92997 WP_000432017.1.93047 WP_000432017.1.9305 WP_000432017.1.93071 WP_000432017.1.93078 WP_000432017.1.93125 WP_000432017.1.93147 WP_000432017.1.93163 WP_000432017.1.93176 WP_000432017.1.93191 WP_000432017.1.93197 WP_000432017.1.93224 WP_000432017.1.93243 WP_000432017.1.93251 WP_000432017.1.93254 WP_000432017.1.93260 WP_000432017.1.93272 WP_000432017.1.93296 WP_000432017.1.93300 WP_000432017.1.93316 WP_000432017.1.93329 WP_000432017.1.93336 WP_000432017.1.93378 WP_000432017.1.93416 WP_000432017.1.93435 WP_000432017.1.93438 WP_000432017.1.93444 WP_000432017.1.9346 WP_000432017.1.93514 WP_000432017.1.9352 WP_000432017.1.9354 WP_000432017.1.93561 WP_000432017.1.93567 WP_000432017.1.93579 WP_000432017.1.9358 WP_000432017.1.93658 WP_000432017.1.93678 WP_000432017.1.93690 WP_000432017.1.93708 WP_000432017.1.93710 WP_000432017.1.93722 WP_000432017.1.93736 WP_000432017.1.93738 WP_000432017.1.93758 WP_000432017.1.93762 WP_000432017.1.93769 WP_000432017.1.93775 WP_000432017.1.93862 WP_000432017.1.9387 WP_000432017.1.93882 WP_000432017.1.93883 WP_000432017.1.93890 WP_000432017.1.93891 WP_000432017.1.93934 WP_000432017.1.93972 WP_000432017.1.9398 WP_000432017.1.94 WP_000432017.1.94009 WP_000432017.1.94016 WP_000432017.1.94053 WP_000432017.1.94060 WP_000432017.1.94074 WP_000432017.1.9408 WP_000432017.1.94080 WP_000432017.1.94082 WP_000432017.1.94087 WP_000432017.1.94096 WP_000432017.1.94114 WP_000432017.1.94119 WP_000432017.1.94122 WP_000432017.1.94123 WP_000432017.1.94165 WP_000432017.1.94172 WP_000432017.1.94242 WP_000432017.1.94245 WP_000432017.1.94248 WP_000432017.1.94268 WP_000432017.1.94287 WP_000432017.1.94293 WP_000432017.1.94294 WP_000432017.1.9430 WP_000432017.1.94319 WP_000432017.1.94320 WP_000432017.1.94324 WP_000432017.1.94325 WP_000432017.1.94335 WP_000432017.1.94337 WP_000432017.1.94340 WP_000432017.1.94341 WP_000432017.1.94345 WP_000432017.1.9435 WP_000432017.1.9437 WP_000432017.1.94374 WP_000432017.1.94375 WP_000432017.1.94389 WP_000432017.1.94409 WP_000432017.1.94414 WP_000432017.1.94484 WP_000432017.1.94505 WP_000432017.1.94530 WP_000432017.1.94536 WP_000432017.1.94549 WP_000432017.1.9455 WP_000432017.1.94550 WP_000432017.1.94576 WP_000432017.1.94636 WP_000432017.1.94641 WP_000432017.1.94688 WP_000432017.1.947 WP_000432017.1.94733 WP_000432017.1.94789 WP_000432017.1.94797 WP_000432017.1.94825 WP_000432017.1.94844 WP_000432017.1.94845 WP_000432017.1.9485 WP_000432017.1.94857 WP_000432017.1.94866 WP_000432017.1.94941 WP_000432017.1.9495 WP_000432017.1.94958 WP_000432017.1.94969 WP_000432017.1.9497 WP_000432017.1.94980 WP_000432017.1.94989 WP_000432017.1.94992 WP_000432017.1.94999 WP_000432017.1.95008 WP_000432017.1.95014 WP_000432017.1.95023 WP_000432017.1.95029 WP_000432017.1.95033 WP_000432017.1.95038 WP_000432017.1.95049 WP_000432017.1.95077 WP_000432017.1.95090 WP_000432017.1.9510 WP_000432017.1.95120 WP_000432017.1.95154 WP_000432017.1.95156 WP_000432017.1.95174 WP_000432017.1.95193 WP_000432017.1.95210 WP_000432017.1.95263 WP_000432017.1.95281 WP_000432017.1.95294 WP_000432017.1.95304 WP_000432017.1.95307 WP_000432017.1.95318 WP_000432017.1.95327 WP_000432017.1.95342 WP_000432017.1.95361 WP_000432017.1.95372 WP_000432017.1.9538 WP_000432017.1.95386 WP_000432017.1.95409 WP_000432017.1.95415 WP_000432017.1.95452 WP_000432017.1.95494 WP_000432017.1.95495 WP_000432017.1.95500 WP_000432017.1.95505 WP_000432017.1.95512 WP_000432017.1.95519 WP_000432017.1.95537 WP_000432017.1.95545 WP_000432017.1.95550 WP_000432017.1.95560 WP_000432017.1.95581 WP_000432017.1.95603 WP_000432017.1.9563 WP_000432017.1.95681 WP_000432017.1.95683 WP_000432017.1.95699 WP_000432017.1.95704 WP_000432017.1.95713 WP_000432017.1.95714 WP_000432017.1.95737 WP_000432017.1.95760 WP_000432017.1.95780 WP_000432017.1.95781 WP_000432017.1.95804 WP_000432017.1.95806 WP_000432017.1.95832 WP_000432017.1.95877 WP_000432017.1.95885 WP_000432017.1.95914 WP_000432017.1.95918 WP_000432017.1.95947 WP_000432017.1.95954 WP_000432017.1.95962 WP_000432017.1.95983 WP_000432017.1.95986 WP_000432017.1.95997 WP_000432017.1.96014 WP_000432017.1.96030 WP_000432017.1.96056 WP_000432017.1.96067 WP_000432017.1.96075 WP_000432017.1.96133 WP_000432017.1.96135 WP_000432017.1.96148 WP_000432017.1.96160 WP_000432017.1.96163 WP_000432017.1.96200 WP_000432017.1.96209 WP_000432017.1.96218 WP_000432017.1.96221 WP_000432017.1.96228 WP_000432017.1.96255 WP_000432017.1.96261 WP_000432017.1.96271 WP_000432017.1.96283 WP_000432017.1.96301 WP_000432017.1.96305 WP_000432017.1.96312 WP_000432017.1.96314 WP_000432017.1.96316 WP_000432017.1.96322 WP_000432017.1.96362 WP_000432017.1.96368 WP_000432017.1.96412 WP_000432017.1.96433 WP_000432017.1.96468 WP_000432017.1.96472 WP_000432017.1.96495 WP_000432017.1.96535 WP_000432017.1.96538 WP_000432017.1.96550 WP_000432017.1.96554 WP_000432017.1.96566 WP_000432017.1.96568 WP_000432017.1.96577 WP_000432017.1.96591 WP_000432017.1.96603 WP_000432017.1.96613 WP_000432017.1.96634 WP_000432017.1.96646 WP_000432017.1.96654 WP_000432017.1.96678 WP_000432017.1.96682 WP_000432017.1.96688 WP_000432017.1.96699 WP_000432017.1.96705 WP_000432017.1.96727 WP_000432017.1.9675 WP_000432017.1.96770 WP_000432017.1.96780 WP_000432017.1.96804 WP_000432017.1.96836 WP_000432017.1.9684 WP_000432017.1.96855 WP_000432017.1.96856 WP_000432017.1.96859 WP_000432017.1.96895 WP_000432017.1.96918 WP_000432017.1.96922 WP_000432017.1.9695 WP_000432017.1.96965 WP_000432017.1.96969 WP_000432017.1.96976 WP_000432017.1.96985 WP_000432017.1.96997 WP_000432017.1.97000 WP_000432017.1.97001 WP_000432017.1.97014 WP_000432017.1.97017 WP_000432017.1.97029 WP_000432017.1.97034 WP_000432017.1.97072 WP_000432017.1.97077 WP_000432017.1.97117 WP_000432017.1.97138 WP_000432017.1.97141 WP_000432017.1.97151 WP_000432017.1.97161 WP_000432017.1.97164 WP_000432017.1.97191 WP_000432017.1.97205 WP_000432017.1.97228 WP_000432017.1.97230 WP_000432017.1.97256 WP_000432017.1.97267 WP_000432017.1.97295 WP_000432017.1.97311 WP_000432017.1.97312 WP_000432017.1.97348 WP_000432017.1.97352 WP_000432017.1.97355 WP_000432017.1.97367 WP_000432017.1.9737 WP_000432017.1.97392 WP_000432017.1.97399 WP_000432017.1.97411 WP_000432017.1.97427 WP_000432017.1.9743 WP_000432017.1.97450 WP_000432017.1.97484 WP_000432017.1.97494 WP_000432017.1.97530 WP_000432017.1.97531 WP_000432017.1.97536 WP_000432017.1.97537 WP_000432017.1.97574 WP_000432017.1.97576 WP_000432017.1.97585 WP_000432017.1.97627 WP_000432017.1.97664 WP_000432017.1.97687 WP_000432017.1.97688 WP_000432017.1.97696 WP_000432017.1.97699 WP_000432017.1.97706 WP_000432017.1.97717 WP_000432017.1.97729 WP_000432017.1.97731 WP_000432017.1.97739 WP_000432017.1.97746 WP_000432017.1.97758 WP_000432017.1.97762 WP_000432017.1.97776 WP_000432017.1.97827 WP_000432017.1.97835 WP_000432017.1.9788 WP_000432017.1.9789 WP_000432017.1.97898 WP_000432017.1.97899 WP_000432017.1.97928 WP_000432017.1.97935 WP_000432017.1.97955 WP_000432017.1.97974 WP_000432017.1.97997 WP_000432017.1.97999 WP_000432017.1.98008 WP_000432017.1.98011 WP_000432017.1.98033 WP_000432017.1.98054 WP_000432017.1.98058 WP_000432017.1.98073 WP_000432017.1.98077 WP_000432017.1.98161 WP_000432017.1.98174 WP_000432017.1.98195 WP_000432017.1.98233 WP_000432017.1.98242 WP_000432017.1.98248 WP_000432017.1.98249 WP_000432017.1.98281 WP_000432017.1.98295 WP_000432017.1.98322 WP_000432017.1.98352 WP_000432017.1.98353 WP_000432017.1.98359 WP_000432017.1.98361 WP_000432017.1.98366 WP_000432017.1.98372 WP_000432017.1.98379 WP_000432017.1.98387 WP_000432017.1.98394 WP_000432017.1.98411 WP_000432017.1.98419 WP_000432017.1.98425 WP_000432017.1.98456 WP_000432017.1.98497 WP_000432017.1.98501 WP_000432017.1.98506 WP_000432017.1.98510 WP_000432017.1.98512 WP_000432017.1.98533 WP_000432017.1.98552 WP_000432017.1.98585 WP_000432017.1.98586 WP_000432017.1.986 WP_000432017.1.98609 WP_000432017.1.98655 WP_000432017.1.98659 WP_000432017.1.98667 WP_000432017.1.98703 WP_000432017.1.98706 WP_000432017.1.9872 WP_000432017.1.98723 WP_000432017.1.98730 WP_000432017.1.98734 WP_000432017.1.98750 WP_000432017.1.98767 WP_000432017.1.98786 WP_000432017.1.98821 WP_000432017.1.98825 WP_000432017.1.98837 WP_000432017.1.98842 WP_000432017.1.98858 WP_000432017.1.98865 WP_000432017.1.98874 WP_000432017.1.98883 WP_000432017.1.98894 WP_000432017.1.98924 WP_000432017.1.98967 WP_000432017.1.98978 WP_000432017.1.98985 WP_000432017.1.99009 WP_000432017.1.99025 WP_000432017.1.9903 WP_000432017.1.99090 WP_000432017.1.9910 WP_000432017.1.99136 WP_000432017.1.99155 WP_000432017.1.99171 WP_000432017.1.99183 WP_000432017.1.99195 WP_000432017.1.99207 WP_000432017.1.99217 WP_000432017.1.99237 WP_000432017.1.99249 WP_000432017.1.99262 WP_000432017.1.99280 WP_000432017.1.99283 WP_000432017.1.99308 WP_000432017.1.99359 WP_000432017.1.9936 WP_000432017.1.99394 WP_000432017.1.99405 WP_000432017.1.99414 WP_000432017.1.99418 WP_000432017.1.99430 WP_000432017.1.99459 WP_000432017.1.99492 WP_000432017.1.99494 WP_000432017.1.99509 WP_000432017.1.99519 WP_000432017.1.99523 WP_000432017.1.99524 WP_000432017.1.99525 WP_000432017.1.99536 WP_000432017.1.99538 WP_000432017.1.99564 WP_000432017.1.9960 WP_000432017.1.99631 WP_000432017.1.99638 WP_000432017.1.9965 WP_000432017.1.99683 WP_000432017.1.99686 WP_000432017.1.99688 WP_000432017.1.99714 WP_000432017.1.99759 WP_000432017.1.99768 WP_000432017.1.99830 WP_000432017.1.99849 WP_000432017.1.9985 WP_000432017.1.99850 WP_000432017.1.99859 WP_000432017.1.99862 WP_000432017.1.9987 WP_000432017.1.99884 WP_000432017.1.99888 WP_000432017.1.99926 WP_000432017.1.99950 WP_000432017.1.99954 WP_000432017.1.99955 WP_000432017.1.99956 WP_000432017.1.99963 WP_000432017.1.99979 WP_000432017.1.99984 WP_000432017.1.99985 WP_000432017.1.99999 YP_498756.1.76163 gi|379013510|ref|YP_005289746.1| gi|387141830|ref|YP_005730223.1| gi|384863548|ref|YP_005748907.1| gi|150392655|ref|YP_001315330.1| gi|384860841|ref|YP_005743561.1| gi|470190454|ref|YP_007576764.1| gi|470221908|ref|YP_007620465.1| gi|470192419|ref|YP_007578772.1| gi|470194384|ref|YP_007580736.1| gi|470196350|ref|YP_007582751.1| gi|87162426|ref|YP_492907.1| gi|532358357|ref|YP_008448186.1| gi|88193969|ref|YP_498756.1| gi|470223873|ref|YP_007622452.1| gi|384866193|ref|YP_005746389.1| gi|470198315|ref|YP_007584715.1| 359787.SaurJH1_0181 451515.SAUSA300_0193 451516.USA300HOU_0205 681288.SAAV_0160 93061.SAOUHSC_00157 gi|161508456|ref|YP_001574115.1| gi|470218085|ref|YP_007618479.1| gi|269201842|ref|YP_003281111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]