SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470190456|ref|YP_007576766.1| from Staphylococcus aureus ST228/10388

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470190456|ref|YP_007576766.1|
Domain Number 1 Region: 99-285
Classification Level Classification E-value
Superfamily SIS domain 1.25e-28
Family mono-SIS domain 0.007
Further Details:      
 
Domain Number 2 Region: 1-79
Classification Level Classification E-value
Superfamily Homeodomain-like 6.09e-23
Family RpiR-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470190456|ref|YP_007576766.1|
Sequence length 292
Comment RpiR family phosphosugar-binding transcriptional regulator [Staphylococcus aureus subsp. aureus ST228]
Sequence
MMTNILYRIDKQLSDFTKTEKIIADYILKNPHKIIDMTVNDLADVTNVSTASIVRFSRKM
THQGFQELKIAISRYLPEDIATNPHLELIENESVETLKNKMIARATNTMRFVATNIMDAQ
IDAICDVLKNARTIFLFGFGASSLTIGDLFQKLSRIGLNVRLLHETHLLVSTFATHDDRD
CMIFVTNQGSHSELQSIAQVATHYSIPIITISSTANNPVAQIADYALIYGRTDENEMRMA
ATTSLFAQLFTVDILYYRFVALNYHAILDCITQSKMALDNYRKHLATIDFKH
Download sequence
Identical sequences A0A0E0VMD2 A0A0E1VW72 A0A0E1XA65 A0A0H3K6E8 T1Y732 W8UU09
gi|49482435|ref|YP_039659.1| gi|386727973|ref|YP_006194356.1| gi|470223875|ref|YP_007622454.1| gi|470221910|ref|YP_007620467.1| gi|470194386|ref|YP_007580738.1| 282458.SAR0194 282459.SAS0168 426430.NWMN_0137 451516.USA300HOU_0207 gi|470198317|ref|YP_007584717.1| gi|470196352|ref|YP_007582753.1| gi|384866191|ref|YP_005746387.1| gi|161508458|ref|YP_001574117.1| gi|49485069|ref|YP_042290.1| gi|470192421|ref|YP_007578774.1| gi|151220349|ref|YP_001331172.1| gi|470218087|ref|YP_007618481.1| gi|521211008|ref|YP_008167354.1| gi|537459917|ref|YP_008490357.1| gi|470190456|ref|YP_007576766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]