SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470190556|ref|YP_007576866.1| from Staphylococcus aureus ST228/10388

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470190556|ref|YP_007576866.1|
Domain Number 1 Region: 84-246
Classification Level Classification E-value
Superfamily SIS domain 2.36e-35
Family mono-SIS domain 0.0092
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Homeodomain-like 1.63e-16
Family RpiR-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470190556|ref|YP_007576866.1|
Sequence length 266
Comment Putative uncharacterized protein [Staphylococcus aureus subsp. aureus ST228]
Sequence
MKFENRVQRYQHLFTKTDKRIVNYIRQNGYSDAFSTINSLAHAIGTSPATMTRFSHKLDY
ENFQDLKFNIQQEMTETVIENSPIIQRIHKYHQQIIQQTGEFIDNDIIQTFIDKLQSSRH
ILFAGLGSSGLSATEFYYRMIRMGLKGNVTTDSHLMKISASLLSHSDMFIAMSNSGNTSE
LISAAEVAKSHGAYVVAITNFEGSKLTDCADLVLLTTDQSRNTDHQFINTQIATLFLINI
VSYHLLENTNLSQTYQHTKSIILDNK
Download sequence
Identical sequences gi|470192521|ref|YP_007578874.1| gi|470218187|ref|YP_007618581.1| gi|470223975|ref|YP_007622554.1| gi|470196452|ref|YP_007582853.1| gi|470222010|ref|YP_007620567.1| gi|470198417|ref|YP_007584817.1| WP_000667384.1.100832 WP_000667384.1.102065 WP_000667384.1.11084 WP_000667384.1.11282 WP_000667384.1.12042 WP_000667384.1.12330 WP_000667384.1.12508 WP_000667384.1.13062 WP_000667384.1.13169 WP_000667384.1.13189 WP_000667384.1.13326 WP_000667384.1.13405 WP_000667384.1.13554 WP_000667384.1.13986 WP_000667384.1.14577 WP_000667384.1.16265 WP_000667384.1.16882 WP_000667384.1.17046 WP_000667384.1.17922 WP_000667384.1.18560 WP_000667384.1.19450 WP_000667384.1.21009 WP_000667384.1.21449 WP_000667384.1.22969 WP_000667384.1.23161 WP_000667384.1.23630 WP_000667384.1.25007 WP_000667384.1.25621 WP_000667384.1.25772 WP_000667384.1.2608 WP_000667384.1.26266 WP_000667384.1.28257 WP_000667384.1.28848 WP_000667384.1.28987 WP_000667384.1.29368 WP_000667384.1.30089 WP_000667384.1.31468 WP_000667384.1.3242 WP_000667384.1.33048 WP_000667384.1.33416 WP_000667384.1.33983 WP_000667384.1.35285 WP_000667384.1.36176 WP_000667384.1.37606 WP_000667384.1.38282 WP_000667384.1.38522 WP_000667384.1.391 WP_000667384.1.39406 WP_000667384.1.40406 WP_000667384.1.40620 WP_000667384.1.41064 WP_000667384.1.42198 WP_000667384.1.4299 WP_000667384.1.43122 WP_000667384.1.43550 WP_000667384.1.43618 WP_000667384.1.45431 WP_000667384.1.46168 WP_000667384.1.46670 WP_000667384.1.46881 WP_000667384.1.4696 WP_000667384.1.46995 WP_000667384.1.47294 WP_000667384.1.47439 WP_000667384.1.4815 WP_000667384.1.48711 WP_000667384.1.4950 WP_000667384.1.50555 WP_000667384.1.50884 WP_000667384.1.515 WP_000667384.1.52185 WP_000667384.1.52623 WP_000667384.1.52624 WP_000667384.1.52687 WP_000667384.1.52699 WP_000667384.1.52722 WP_000667384.1.54253 WP_000667384.1.54510 WP_000667384.1.55558 WP_000667384.1.56598 WP_000667384.1.5666 WP_000667384.1.56778 WP_000667384.1.569 WP_000667384.1.57047 WP_000667384.1.57878 WP_000667384.1.5791 WP_000667384.1.5940 WP_000667384.1.59498 WP_000667384.1.59787 WP_000667384.1.60492 WP_000667384.1.60758 WP_000667384.1.61082 WP_000667384.1.61430 WP_000667384.1.61615 WP_000667384.1.61800 WP_000667384.1.63678 WP_000667384.1.64928 WP_000667384.1.65243 WP_000667384.1.65931 WP_000667384.1.661 WP_000667384.1.67520 WP_000667384.1.6839 WP_000667384.1.68397 WP_000667384.1.68737 WP_000667384.1.69222 WP_000667384.1.69552 WP_000667384.1.71257 WP_000667384.1.7150 WP_000667384.1.71861 WP_000667384.1.73019 WP_000667384.1.74237 WP_000667384.1.75038 WP_000667384.1.75044 WP_000667384.1.758 WP_000667384.1.76010 WP_000667384.1.76261 WP_000667384.1.78054 WP_000667384.1.78091 WP_000667384.1.78819 WP_000667384.1.8035 WP_000667384.1.8065 WP_000667384.1.81800 WP_000667384.1.82053 WP_000667384.1.8265 WP_000667384.1.82829 WP_000667384.1.85404 WP_000667384.1.85519 WP_000667384.1.87141 WP_000667384.1.88317 WP_000667384.1.88694 WP_000667384.1.89935 WP_000667384.1.91054 WP_000667384.1.91177 WP_000667384.1.91300 WP_000667384.1.91749 WP_000667384.1.92173 WP_000667384.1.92565 WP_000667384.1.94797 WP_000667384.1.94989 WP_000667384.1.97029 WP_000667384.1.97352 WP_000667384.1.98054 WP_000667384.1.98894 WP_000667384.1.98978 WP_000667384.1.98985 gi|470194486|ref|YP_007580838.1| gi|470190556|ref|YP_007576866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]