SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470190738|ref|YP_007577048.1| from Staphylococcus aureus ST228/10388

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470190738|ref|YP_007577048.1|
Domain Number 1 Region: 8-181
Classification Level Classification E-value
Superfamily SIS domain 1.78e-35
Family mono-SIS domain 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470190738|ref|YP_007577048.1|
Sequence length 182
Comment Putative uncharacterized protein [Staphylococcus aureus subsp. aureus ST228]
Sequence
MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQ
LGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIG
NLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHAN
LE
Download sequence
Identical sequences A0A0E0VMC9 A0A0E1AHT7 A0A0H2WYK9 A0A0H3JJZ7 A0A0H3JQQ4 A0A0H3KB62 A0A1E5JAZ0 A0A1E8X3M6 A0A2H5ALL3 A0A2K4B1S9 W8U665
gi|470218371|ref|YP_007618765.1| gi|470192704|ref|YP_007579057.1| gi|161353531|ref|YP_499126.2| gi|470196634|ref|YP_007583035.1| gi|384546851|ref|YP_005736104.1| gi|470190738|ref|YP_007577048.1| gi|379013853|ref|YP_005290089.1| gi|554643368|ref|YP_008715159.1| gi|384863900|ref|YP_005749259.1| gi|156978900|ref|YP_001441159.1| gi|387149733|ref|YP_005741297.1| gi|386728329|ref|YP_006194712.1| gi|148267031|ref|YP_001245974.1| gi|384869157|ref|YP_005751871.1| gi|470222192|ref|YP_007620749.1| gi|269202194|ref|YP_003281463.1| gi|57651447|ref|YP_185503.1| gi|470198601|ref|YP_007585001.1| WP_001051594.1.100013 WP_001051594.1.100041 WP_001051594.1.100049 WP_001051594.1.100057 WP_001051594.1.10006 WP_001051594.1.100067 WP_001051594.1.100072 WP_001051594.1.100088 WP_001051594.1.100090 WP_001051594.1.100094 WP_001051594.1.100122 WP_001051594.1.10014 WP_001051594.1.100154 WP_001051594.1.100171 WP_001051594.1.100180 WP_001051594.1.100184 WP_001051594.1.100189 WP_001051594.1.100235 WP_001051594.1.100265 WP_001051594.1.100272 WP_001051594.1.100298 WP_001051594.1.100307 WP_001051594.1.100310 WP_001051594.1.10032 WP_001051594.1.100335 WP_001051594.1.100347 WP_001051594.1.100352 WP_001051594.1.100366 WP_001051594.1.100391 WP_001051594.1.100399 WP_001051594.1.10041 WP_001051594.1.100452 WP_001051594.1.10046 WP_001051594.1.100464 WP_001051594.1.10050 WP_001051594.1.100534 WP_001051594.1.100535 WP_001051594.1.100562 WP_001051594.1.100582 WP_001051594.1.100596 WP_001051594.1.100618 WP_001051594.1.100631 WP_001051594.1.100647 WP_001051594.1.100665 WP_001051594.1.100678 WP_001051594.1.100693 WP_001051594.1.100699 WP_001051594.1.100704 WP_001051594.1.100719 WP_001051594.1.100726 WP_001051594.1.100761 WP_001051594.1.100768 WP_001051594.1.100823 WP_001051594.1.100832 WP_001051594.1.100834 WP_001051594.1.100860 WP_001051594.1.100888 WP_001051594.1.100903 WP_001051594.1.100920 WP_001051594.1.100922 WP_001051594.1.100934 WP_001051594.1.100963 WP_001051594.1.10097 WP_001051594.1.100981 WP_001051594.1.100987 WP_001051594.1.101002 WP_001051594.1.101017 WP_001051594.1.101027 WP_001051594.1.101055 WP_001051594.1.101058 WP_001051594.1.101068 WP_001051594.1.101071 WP_001051594.1.101072 WP_001051594.1.101084 WP_001051594.1.101103 WP_001051594.1.10111 WP_001051594.1.101160 WP_001051594.1.101177 WP_001051594.1.101192 WP_001051594.1.101217 WP_001051594.1.101240 WP_001051594.1.101262 WP_001051594.1.101266 WP_001051594.1.101298 WP_001051594.1.101327 WP_001051594.1.101329 WP_001051594.1.101352 WP_001051594.1.101375 WP_001051594.1.101379 WP_001051594.1.101393 WP_001051594.1.101414 WP_001051594.1.101440 WP_001051594.1.101441 WP_001051594.1.10148 WP_001051594.1.101490 WP_001051594.1.101495 WP_001051594.1.101505 WP_001051594.1.101511 WP_001051594.1.101531 WP_001051594.1.101566 WP_001051594.1.101567 WP_001051594.1.101570 WP_001051594.1.101615 WP_001051594.1.10165 WP_001051594.1.10166 WP_001051594.1.101661 WP_001051594.1.101670 WP_001051594.1.101691 WP_001051594.1.101704 WP_001051594.1.101725 WP_001051594.1.101728 WP_001051594.1.101745 WP_001051594.1.101757 WP_001051594.1.101778 WP_001051594.1.101788 WP_001051594.1.101813 WP_001051594.1.101820 WP_001051594.1.101821 WP_001051594.1.101825 WP_001051594.1.101852 WP_001051594.1.101902 WP_001051594.1.101906 WP_001051594.1.101922 WP_001051594.1.101943 WP_001051594.1.101950 WP_001051594.1.101999 WP_001051594.1.102065 WP_001051594.1.102096 WP_001051594.1.102123 WP_001051594.1.102126 WP_001051594.1.102130 WP_001051594.1.102132 WP_001051594.1.1022 WP_001051594.1.10232 WP_001051594.1.10238 WP_001051594.1.1025 WP_001051594.1.10274 WP_001051594.1.1031 WP_001051594.1.10343 WP_001051594.1.10358 WP_001051594.1.10397 WP_001051594.1.1043 WP_001051594.1.10431 WP_001051594.1.10436 WP_001051594.1.10469 WP_001051594.1.10478 WP_001051594.1.10481 WP_001051594.1.10486 WP_001051594.1.10503 WP_001051594.1.1052 WP_001051594.1.10526 WP_001051594.1.10542 WP_001051594.1.10543 WP_001051594.1.10565 WP_001051594.1.10583 WP_001051594.1.1060 WP_001051594.1.10614 WP_001051594.1.10617 WP_001051594.1.10624 WP_001051594.1.10644 WP_001051594.1.10679 WP_001051594.1.10707 WP_001051594.1.10726 WP_001051594.1.10742 WP_001051594.1.10749 WP_001051594.1.10751 WP_001051594.1.1077 WP_001051594.1.10785 WP_001051594.1.10823 WP_001051594.1.10843 WP_001051594.1.10858 WP_001051594.1.1087 WP_001051594.1.10919 WP_001051594.1.10942 WP_001051594.1.10950 WP_001051594.1.10976 WP_001051594.1.10979 WP_001051594.1.10985 WP_001051594.1.11001 WP_001051594.1.11069 WP_001051594.1.11073 WP_001051594.1.11083 WP_001051594.1.11084 WP_001051594.1.11129 WP_001051594.1.1115 WP_001051594.1.11162 WP_001051594.1.11188 WP_001051594.1.1120 WP_001051594.1.11220 WP_001051594.1.11223 WP_001051594.1.1124 WP_001051594.1.11261 WP_001051594.1.11281 WP_001051594.1.11282 WP_001051594.1.11286 WP_001051594.1.11294 WP_001051594.1.11322 WP_001051594.1.11333 WP_001051594.1.11348 WP_001051594.1.11353 WP_001051594.1.1136 WP_001051594.1.11377 WP_001051594.1.11378 WP_001051594.1.11403 WP_001051594.1.11407 WP_001051594.1.11447 WP_001051594.1.11451 WP_001051594.1.1147 WP_001051594.1.11475 WP_001051594.1.11488 WP_001051594.1.11504 WP_001051594.1.11513 WP_001051594.1.11525 WP_001051594.1.11556 WP_001051594.1.11558 WP_001051594.1.11592 WP_001051594.1.11611 WP_001051594.1.11640 WP_001051594.1.11646 WP_001051594.1.11655 WP_001051594.1.11660 WP_001051594.1.11663 WP_001051594.1.11692 WP_001051594.1.117 WP_001051594.1.1171 WP_001051594.1.11719 WP_001051594.1.11720 WP_001051594.1.11730 WP_001051594.1.11736 WP_001051594.1.11741 WP_001051594.1.11768 WP_001051594.1.11781 WP_001051594.1.11794 WP_001051594.1.11795 WP_001051594.1.11816 WP_001051594.1.11829 WP_001051594.1.11837 WP_001051594.1.11884 WP_001051594.1.11903 WP_001051594.1.11919 WP_001051594.1.11991 WP_001051594.1.12005 WP_001051594.1.12019 WP_001051594.1.12042 WP_001051594.1.1205 WP_001051594.1.12073 WP_001051594.1.12098 WP_001051594.1.12123 WP_001051594.1.12152 WP_001051594.1.12170 WP_001051594.1.12175 WP_001051594.1.12179 WP_001051594.1.12181 WP_001051594.1.12226 WP_001051594.1.12233 WP_001051594.1.12234 WP_001051594.1.12256 WP_001051594.1.12297 WP_001051594.1.12328 WP_001051594.1.12330 WP_001051594.1.12361 WP_001051594.1.12366 WP_001051594.1.12391 WP_001051594.1.12436 WP_001051594.1.12437 WP_001051594.1.12447 WP_001051594.1.12498 WP_001051594.1.12508 WP_001051594.1.1257 WP_001051594.1.12598 WP_001051594.1.12605 WP_001051594.1.12608 WP_001051594.1.12618 WP_001051594.1.12639 WP_001051594.1.12685 WP_001051594.1.12705 WP_001051594.1.12715 WP_001051594.1.12733 WP_001051594.1.12737 WP_001051594.1.12770 WP_001051594.1.12771 WP_001051594.1.12780 WP_001051594.1.12788 WP_001051594.1.12802 WP_001051594.1.12822 WP_001051594.1.12829 WP_001051594.1.12833 WP_001051594.1.12845 WP_001051594.1.12858 WP_001051594.1.12862 WP_001051594.1.12884 WP_001051594.1.12903 WP_001051594.1.12904 WP_001051594.1.12918 WP_001051594.1.12920 WP_001051594.1.12937 WP_001051594.1.12938 WP_001051594.1.12951 WP_001051594.1.12977 WP_001051594.1.13013 WP_001051594.1.13039 WP_001051594.1.13062 WP_001051594.1.13072 WP_001051594.1.13091 WP_001051594.1.13104 WP_001051594.1.13112 WP_001051594.1.13154 WP_001051594.1.13164 WP_001051594.1.13169 WP_001051594.1.13189 WP_001051594.1.13243 WP_001051594.1.13250 WP_001051594.1.13303 WP_001051594.1.13322 WP_001051594.1.13326 WP_001051594.1.13355 WP_001051594.1.13366 WP_001051594.1.13376 WP_001051594.1.13379 WP_001051594.1.13405 WP_001051594.1.13448 WP_001051594.1.13468 WP_001051594.1.1347 WP_001051594.1.13486 WP_001051594.1.13514 WP_001051594.1.13531 WP_001051594.1.1355 WP_001051594.1.13554 WP_001051594.1.13556 WP_001051594.1.13568 WP_001051594.1.13612 WP_001051594.1.13617 WP_001051594.1.13650 WP_001051594.1.13654 WP_001051594.1.13665 WP_001051594.1.13668 WP_001051594.1.13670 WP_001051594.1.13683 WP_001051594.1.13726 WP_001051594.1.13727 WP_001051594.1.13728 WP_001051594.1.1374 WP_001051594.1.13755 WP_001051594.1.13757 WP_001051594.1.13769 WP_001051594.1.13772 WP_001051594.1.13804 WP_001051594.1.13805 WP_001051594.1.13870 WP_001051594.1.13879 WP_001051594.1.13884 WP_001051594.1.13897 WP_001051594.1.13914 WP_001051594.1.13933 WP_001051594.1.13940 WP_001051594.1.13948 WP_001051594.1.13983 WP_001051594.1.13986 WP_001051594.1.13987 WP_001051594.1.14025 WP_001051594.1.14071 WP_001051594.1.14076 WP_001051594.1.14097 WP_001051594.1.14112 WP_001051594.1.14143 WP_001051594.1.14153 WP_001051594.1.14163 WP_001051594.1.1418 WP_001051594.1.1420 WP_001051594.1.14201 WP_001051594.1.14233 WP_001051594.1.1425 WP_001051594.1.1426 WP_001051594.1.1429 WP_001051594.1.14298 WP_001051594.1.14305 WP_001051594.1.14337 WP_001051594.1.14342 WP_001051594.1.14349 WP_001051594.1.14358 WP_001051594.1.14363 WP_001051594.1.14364 WP_001051594.1.14365 WP_001051594.1.14394 WP_001051594.1.14397 WP_001051594.1.14412 WP_001051594.1.14418 WP_001051594.1.14475 WP_001051594.1.14535 WP_001051594.1.14577 WP_001051594.1.14590 WP_001051594.1.14596 WP_001051594.1.14639 WP_001051594.1.14665 WP_001051594.1.1468 WP_001051594.1.14681 WP_001051594.1.14696 WP_001051594.1.147 WP_001051594.1.14729 WP_001051594.1.14734 WP_001051594.1.14744 WP_001051594.1.1477 WP_001051594.1.14774 WP_001051594.1.14790 WP_001051594.1.14809 WP_001051594.1.14825 WP_001051594.1.14846 WP_001051594.1.14869 WP_001051594.1.14874 WP_001051594.1.14888 WP_001051594.1.14902 WP_001051594.1.14967 WP_001051594.1.14970 WP_001051594.1.14987 WP_001051594.1.15000 WP_001051594.1.15015 WP_001051594.1.15029 WP_001051594.1.15071 WP_001051594.1.15091 WP_001051594.1.15098 WP_001051594.1.15108 WP_001051594.1.15173 WP_001051594.1.15185 WP_001051594.1.1520 WP_001051594.1.15201 WP_001051594.1.15228 WP_001051594.1.1525 WP_001051594.1.15255 WP_001051594.1.15263 WP_001051594.1.15268 WP_001051594.1.15269 WP_001051594.1.15278 WP_001051594.1.15294 WP_001051594.1.15296 WP_001051594.1.15329 WP_001051594.1.15399 WP_001051594.1.15403 WP_001051594.1.15409 WP_001051594.1.15421 WP_001051594.1.15438 WP_001051594.1.1545 WP_001051594.1.15489 WP_001051594.1.15505 WP_001051594.1.15524 WP_001051594.1.15532 WP_001051594.1.15533 WP_001051594.1.15544 WP_001051594.1.15546 WP_001051594.1.15572 WP_001051594.1.1558 WP_001051594.1.15590 WP_001051594.1.15591 WP_001051594.1.1564 WP_001051594.1.15679 WP_001051594.1.15687 WP_001051594.1.1569 WP_001051594.1.15691 WP_001051594.1.15706 WP_001051594.1.15722 WP_001051594.1.15785 WP_001051594.1.1579 WP_001051594.1.15812 WP_001051594.1.15818 WP_001051594.1.15819 WP_001051594.1.1583 WP_001051594.1.15838 WP_001051594.1.15883 WP_001051594.1.15888 WP_001051594.1.15892 WP_001051594.1.15897 WP_001051594.1.15898 WP_001051594.1.159 WP_001051594.1.15920 WP_001051594.1.15921 WP_001051594.1.15925 WP_001051594.1.15928 WP_001051594.1.15948 WP_001051594.1.15957 WP_001051594.1.15972 WP_001051594.1.1600 WP_001051594.1.16018 WP_001051594.1.1606 WP_001051594.1.16068 WP_001051594.1.16096 WP_001051594.1.16098 WP_001051594.1.16112 WP_001051594.1.16140 WP_001051594.1.16157 WP_001051594.1.16173 WP_001051594.1.16195 WP_001051594.1.16203 WP_001051594.1.16213 WP_001051594.1.16223 WP_001051594.1.1623 WP_001051594.1.16237 WP_001051594.1.16251 WP_001051594.1.16265 WP_001051594.1.16276 WP_001051594.1.16311 WP_001051594.1.16362 WP_001051594.1.16395 WP_001051594.1.16407 WP_001051594.1.16417 WP_001051594.1.16436 WP_001051594.1.16455 WP_001051594.1.16458 WP_001051594.1.16467 WP_001051594.1.16554 WP_001051594.1.16589 WP_001051594.1.16603 WP_001051594.1.16617 WP_001051594.1.16628 WP_001051594.1.16632 WP_001051594.1.16639 WP_001051594.1.1665 WP_001051594.1.16653 WP_001051594.1.16679 WP_001051594.1.16688 WP_001051594.1.16693 WP_001051594.1.16703 WP_001051594.1.16747 WP_001051594.1.16757 WP_001051594.1.16761 WP_001051594.1.16768 WP_001051594.1.16770 WP_001051594.1.16776 WP_001051594.1.16794 WP_001051594.1.16815 WP_001051594.1.16824 WP_001051594.1.16880 WP_001051594.1.16882 WP_001051594.1.16892 WP_001051594.1.16920 WP_001051594.1.16925 WP_001051594.1.16946 WP_001051594.1.16969 WP_001051594.1.170 WP_001051594.1.17009 WP_001051594.1.17012 WP_001051594.1.17038 WP_001051594.1.17046 WP_001051594.1.17080 WP_001051594.1.17104 WP_001051594.1.17122 WP_001051594.1.17132 WP_001051594.1.17137 WP_001051594.1.17139 WP_001051594.1.17143 WP_001051594.1.17157 WP_001051594.1.17169 WP_001051594.1.17176 WP_001051594.1.17180 WP_001051594.1.17210 WP_001051594.1.17231 WP_001051594.1.17234 WP_001051594.1.17240 WP_001051594.1.17249 WP_001051594.1.1725 WP_001051594.1.17256 WP_001051594.1.17289 WP_001051594.1.1729 WP_001051594.1.17309 WP_001051594.1.17320 WP_001051594.1.17327 WP_001051594.1.1736 WP_001051594.1.1741 WP_001051594.1.17419 WP_001051594.1.17450 WP_001051594.1.17454 WP_001051594.1.17485 WP_001051594.1.17520 WP_001051594.1.17529 WP_001051594.1.17531 WP_001051594.1.1756 WP_001051594.1.17569 WP_001051594.1.17581 WP_001051594.1.17590 WP_001051594.1.17643 WP_001051594.1.1765 WP_001051594.1.17650 WP_001051594.1.17657 WP_001051594.1.17666 WP_001051594.1.17671 WP_001051594.1.17676 WP_001051594.1.17717 WP_001051594.1.17718 WP_001051594.1.17725 WP_001051594.1.17729 WP_001051594.1.17737 WP_001051594.1.17770 WP_001051594.1.17796 WP_001051594.1.17818 WP_001051594.1.17832 WP_001051594.1.17834 WP_001051594.1.17845 WP_001051594.1.17847 WP_001051594.1.17853 WP_001051594.1.17859 WP_001051594.1.17876 WP_001051594.1.17909 WP_001051594.1.17922 WP_001051594.1.17928 WP_001051594.1.17929 WP_001051594.1.17943 WP_001051594.1.17951 WP_001051594.1.17987 WP_001051594.1.18011 WP_001051594.1.18016 WP_001051594.1.18035 WP_001051594.1.18043 WP_001051594.1.18069 WP_001051594.1.18074 WP_001051594.1.18080 WP_001051594.1.18105 WP_001051594.1.18113 WP_001051594.1.18140 WP_001051594.1.18153 WP_001051594.1.18197 WP_001051594.1.18203 WP_001051594.1.18237 WP_001051594.1.18248 WP_001051594.1.18261 WP_001051594.1.18283 WP_001051594.1.18288 WP_001051594.1.1829 WP_001051594.1.18290 WP_001051594.1.18301 WP_001051594.1.18309 WP_001051594.1.18310 WP_001051594.1.18320 WP_001051594.1.18346 WP_001051594.1.1835 WP_001051594.1.18360 WP_001051594.1.18412 WP_001051594.1.18429 WP_001051594.1.18437 WP_001051594.1.18451 WP_001051594.1.1847 WP_001051594.1.18487 WP_001051594.1.18495 WP_001051594.1.18506 WP_001051594.1.18507 WP_001051594.1.1851 WP_001051594.1.18516 WP_001051594.1.18529 WP_001051594.1.18538 WP_001051594.1.18539 WP_001051594.1.18560 WP_001051594.1.18562 WP_001051594.1.18570 WP_001051594.1.18591 WP_001051594.1.18611 WP_001051594.1.18627 WP_001051594.1.18656 WP_001051594.1.18658 WP_001051594.1.18668 WP_001051594.1.18679 WP_001051594.1.18719 WP_001051594.1.18741 WP_001051594.1.18758 WP_001051594.1.18777 WP_001051594.1.18792 WP_001051594.1.18809 WP_001051594.1.18818 WP_001051594.1.18819 WP_001051594.1.18830 WP_001051594.1.18834 WP_001051594.1.18836 WP_001051594.1.18879 WP_001051594.1.18882 WP_001051594.1.18918 WP_001051594.1.1892 WP_001051594.1.18938 WP_001051594.1.18963 WP_001051594.1.18965 WP_001051594.1.18968 WP_001051594.1.18987 WP_001051594.1.18996 WP_001051594.1.19009 WP_001051594.1.1901 WP_001051594.1.19014 WP_001051594.1.19027 WP_001051594.1.19052 WP_001051594.1.19082 WP_001051594.1.19102 WP_001051594.1.1911 WP_001051594.1.19149 WP_001051594.1.19179 WP_001051594.1.192 WP_001051594.1.1921 WP_001051594.1.19272 WP_001051594.1.19301 WP_001051594.1.19306 WP_001051594.1.19322 WP_001051594.1.19375 WP_001051594.1.19377 WP_001051594.1.19390 WP_001051594.1.19399 WP_001051594.1.19411 WP_001051594.1.1943 WP_001051594.1.19430 WP_001051594.1.19444 WP_001051594.1.19450 WP_001051594.1.19509 WP_001051594.1.19537 WP_001051594.1.19555 WP_001051594.1.19577 WP_001051594.1.19611 WP_001051594.1.1964 WP_001051594.1.19643 WP_001051594.1.19700 WP_001051594.1.19701 WP_001051594.1.19725 WP_001051594.1.19732 WP_001051594.1.19733 WP_001051594.1.1974 WP_001051594.1.19748 WP_001051594.1.1975 WP_001051594.1.19759 WP_001051594.1.19765 WP_001051594.1.19775 WP_001051594.1.19788 WP_001051594.1.19807 WP_001051594.1.19816 WP_001051594.1.19848 WP_001051594.1.19853 WP_001051594.1.19881 WP_001051594.1.19891 WP_001051594.1.19912 WP_001051594.1.19921 WP_001051594.1.19977 WP_001051594.1.19981 WP_001051594.1.19982 WP_001051594.1.20006 WP_001051594.1.20049 WP_001051594.1.20052 WP_001051594.1.20057 WP_001051594.1.2007 WP_001051594.1.20078 WP_001051594.1.2008 WP_001051594.1.20090 WP_001051594.1.20100 WP_001051594.1.20101 WP_001051594.1.2013 WP_001051594.1.20155 WP_001051594.1.20156 WP_001051594.1.20160 WP_001051594.1.20161 WP_001051594.1.20167 WP_001051594.1.20191 WP_001051594.1.20210 WP_001051594.1.20235 WP_001051594.1.20245 WP_001051594.1.20265 WP_001051594.1.20324 WP_001051594.1.20340 WP_001051594.1.20354 WP_001051594.1.20386 WP_001051594.1.20394 WP_001051594.1.20398 WP_001051594.1.20399 WP_001051594.1.20411 WP_001051594.1.20447 WP_001051594.1.20473 WP_001051594.1.20479 WP_001051594.1.20487 WP_001051594.1.20554 WP_001051594.1.20558 WP_001051594.1.20574 WP_001051594.1.20579 WP_001051594.1.20585 WP_001051594.1.20611 WP_001051594.1.20619 WP_001051594.1.20620 WP_001051594.1.20649 WP_001051594.1.20661 WP_001051594.1.20698 WP_001051594.1.20736 WP_001051594.1.20772 WP_001051594.1.20796 WP_001051594.1.20821 WP_001051594.1.20833 WP_001051594.1.20838 WP_001051594.1.20846 WP_001051594.1.20860 WP_001051594.1.20867 WP_001051594.1.20878 WP_001051594.1.20913 WP_001051594.1.20922 WP_001051594.1.20935 WP_001051594.1.20939 WP_001051594.1.20945 WP_001051594.1.20971 WP_001051594.1.20975 WP_001051594.1.21009 WP_001051594.1.21013 WP_001051594.1.21031 WP_001051594.1.21054 WP_001051594.1.21056 WP_001051594.1.21064 WP_001051594.1.21066 WP_001051594.1.21078 WP_001051594.1.21080 WP_001051594.1.21081 WP_001051594.1.21102 WP_001051594.1.21109 WP_001051594.1.21111 WP_001051594.1.21154 WP_001051594.1.21183 WP_001051594.1.2119 WP_001051594.1.21257 WP_001051594.1.21272 WP_001051594.1.2128 WP_001051594.1.2129 WP_001051594.1.21312 WP_001051594.1.21330 WP_001051594.1.21339 WP_001051594.1.2135 WP_001051594.1.21356 WP_001051594.1.21359 WP_001051594.1.21379 WP_001051594.1.21386 WP_001051594.1.21393 WP_001051594.1.21402 WP_001051594.1.21412 WP_001051594.1.21449 WP_001051594.1.21464 WP_001051594.1.21465 WP_001051594.1.21480 WP_001051594.1.21500 WP_001051594.1.21511 WP_001051594.1.21514 WP_001051594.1.2154 WP_001051594.1.21572 WP_001051594.1.21583 WP_001051594.1.2159 WP_001051594.1.2160 WP_001051594.1.21601 WP_001051594.1.21621 WP_001051594.1.21636 WP_001051594.1.21679 WP_001051594.1.21712 WP_001051594.1.21724 WP_001051594.1.21746 WP_001051594.1.21763 WP_001051594.1.21787 WP_001051594.1.21820 WP_001051594.1.21828 WP_001051594.1.21830 WP_001051594.1.21890 WP_001051594.1.21894 WP_001051594.1.21901 WP_001051594.1.21954 WP_001051594.1.21988 WP_001051594.1.22022 WP_001051594.1.22027 WP_001051594.1.22045 WP_001051594.1.22082 WP_001051594.1.22093 WP_001051594.1.2211 WP_001051594.1.22111 WP_001051594.1.22149 WP_001051594.1.22163 WP_001051594.1.22165 WP_001051594.1.22170 WP_001051594.1.22174 WP_001051594.1.22177 WP_001051594.1.22197 WP_001051594.1.22200 WP_001051594.1.22227 WP_001051594.1.22246 WP_001051594.1.22302 WP_001051594.1.22332 WP_001051594.1.22344 WP_001051594.1.22351 WP_001051594.1.22367 WP_001051594.1.22369 WP_001051594.1.22400 WP_001051594.1.22418 WP_001051594.1.22493 WP_001051594.1.22526 WP_001051594.1.22531 WP_001051594.1.22533 WP_001051594.1.22551 WP_001051594.1.22559 WP_001051594.1.22650 WP_001051594.1.22657 WP_001051594.1.22696 WP_001051594.1.22702 WP_001051594.1.22709 WP_001051594.1.22727 WP_001051594.1.22730 WP_001051594.1.22731 WP_001051594.1.22738 WP_001051594.1.22739 WP_001051594.1.22789 WP_001051594.1.22790 WP_001051594.1.22792 WP_001051594.1.2280 WP_001051594.1.22803 WP_001051594.1.22811 WP_001051594.1.22843 WP_001051594.1.22853 WP_001051594.1.22861 WP_001051594.1.22869 WP_001051594.1.22890 WP_001051594.1.22969 WP_001051594.1.22975 WP_001051594.1.22994 WP_001051594.1.23004 WP_001051594.1.23008 WP_001051594.1.23048 WP_001051594.1.23061 WP_001051594.1.23069 WP_001051594.1.23082 WP_001051594.1.23103 WP_001051594.1.23121 WP_001051594.1.23130 WP_001051594.1.23132 WP_001051594.1.23133 WP_001051594.1.23152 WP_001051594.1.23161 WP_001051594.1.23185 WP_001051594.1.23197 WP_001051594.1.23217 WP_001051594.1.23222 WP_001051594.1.23228 WP_001051594.1.23238 WP_001051594.1.23244 WP_001051594.1.2327 WP_001051594.1.23275 WP_001051594.1.23288 WP_001051594.1.23381 WP_001051594.1.23413 WP_001051594.1.23420 WP_001051594.1.23449 WP_001051594.1.23450 WP_001051594.1.23489 WP_001051594.1.23491 WP_001051594.1.23516 WP_001051594.1.23531 WP_001051594.1.23541 WP_001051594.1.23544 WP_001051594.1.23572 WP_001051594.1.23580 WP_001051594.1.23586 WP_001051594.1.23613 WP_001051594.1.23626 WP_001051594.1.23630 WP_001051594.1.23644 WP_001051594.1.2365 WP_001051594.1.23690 WP_001051594.1.23740 WP_001051594.1.23796 WP_001051594.1.23809 WP_001051594.1.2382 WP_001051594.1.23822 WP_001051594.1.23842 WP_001051594.1.23849 WP_001051594.1.23856 WP_001051594.1.2389 WP_001051594.1.23896 WP_001051594.1.23900 WP_001051594.1.23902 WP_001051594.1.23907 WP_001051594.1.23935 WP_001051594.1.23944 WP_001051594.1.23956 WP_001051594.1.23972 WP_001051594.1.23995 WP_001051594.1.23998 WP_001051594.1.24000 WP_001051594.1.24129 WP_001051594.1.24148 WP_001051594.1.24167 WP_001051594.1.24174 WP_001051594.1.2420 WP_001051594.1.24207 WP_001051594.1.24213 WP_001051594.1.2423 WP_001051594.1.24241 WP_001051594.1.24263 WP_001051594.1.2427 WP_001051594.1.24275 WP_001051594.1.24277 WP_001051594.1.24279 WP_001051594.1.24343 WP_001051594.1.24364 WP_001051594.1.24416 WP_001051594.1.24418 WP_001051594.1.2442 WP_001051594.1.24437 WP_001051594.1.24443 WP_001051594.1.24462 WP_001051594.1.24469 WP_001051594.1.24478 WP_001051594.1.2450 WP_001051594.1.2458 WP_001051594.1.24589 WP_001051594.1.24596 WP_001051594.1.24602 WP_001051594.1.24617 WP_001051594.1.24679 WP_001051594.1.24684 WP_001051594.1.24702 WP_001051594.1.24745 WP_001051594.1.24781 WP_001051594.1.2480 WP_001051594.1.24802 WP_001051594.1.24823 WP_001051594.1.24855 WP_001051594.1.24891 WP_001051594.1.24903 WP_001051594.1.2497 WP_001051594.1.25007 WP_001051594.1.2501 WP_001051594.1.25012 WP_001051594.1.25029 WP_001051594.1.2506 WP_001051594.1.25070 WP_001051594.1.25083 WP_001051594.1.25092 WP_001051594.1.25098 WP_001051594.1.25115 WP_001051594.1.25120 WP_001051594.1.25167 WP_001051594.1.25170 WP_001051594.1.25209 WP_001051594.1.2522 WP_001051594.1.25287 WP_001051594.1.25361 WP_001051594.1.25433 WP_001051594.1.25438 WP_001051594.1.25459 WP_001051594.1.25469 WP_001051594.1.25479 WP_001051594.1.25489 WP_001051594.1.25511 WP_001051594.1.2552 WP_001051594.1.25557 WP_001051594.1.25567 WP_001051594.1.25593 WP_001051594.1.25595 WP_001051594.1.25621 WP_001051594.1.25623 WP_001051594.1.25633 WP_001051594.1.25634 WP_001051594.1.257 WP_001051594.1.25721 WP_001051594.1.25737 WP_001051594.1.25758 WP_001051594.1.25770 WP_001051594.1.25772 WP_001051594.1.25776 WP_001051594.1.25779 WP_001051594.1.2579 WP_001051594.1.25801 WP_001051594.1.25802 WP_001051594.1.25820 WP_001051594.1.25840 WP_001051594.1.25852 WP_001051594.1.25856 WP_001051594.1.25857 WP_001051594.1.25867 WP_001051594.1.25868 WP_001051594.1.25881 WP_001051594.1.25891 WP_001051594.1.2590 WP_001051594.1.25910 WP_001051594.1.25924 WP_001051594.1.2593 WP_001051594.1.25930 WP_001051594.1.26006 WP_001051594.1.26012 WP_001051594.1.26015 WP_001051594.1.26039 WP_001051594.1.2608 WP_001051594.1.26086 WP_001051594.1.26106 WP_001051594.1.26169 WP_001051594.1.26172 WP_001051594.1.2619 WP_001051594.1.2621 WP_001051594.1.26255 WP_001051594.1.26266 WP_001051594.1.26276 WP_001051594.1.26289 WP_001051594.1.26290 WP_001051594.1.26293 WP_001051594.1.26298 WP_001051594.1.26307 WP_001051594.1.26314 WP_001051594.1.26318 WP_001051594.1.2633 WP_001051594.1.26340 WP_001051594.1.26345 WP_001051594.1.26346 WP_001051594.1.26354 WP_001051594.1.26359 WP_001051594.1.26364 WP_001051594.1.26370 WP_001051594.1.26397 WP_001051594.1.26399 WP_001051594.1.26404 WP_001051594.1.26405 WP_001051594.1.2643 WP_001051594.1.2645 WP_001051594.1.26481 WP_001051594.1.26506 WP_001051594.1.2656 WP_001051594.1.2658 WP_001051594.1.26584 WP_001051594.1.2661 WP_001051594.1.26626 WP_001051594.1.2664 WP_001051594.1.26662 WP_001051594.1.26663 WP_001051594.1.26677 WP_001051594.1.26692 WP_001051594.1.2673 WP_001051594.1.26733 WP_001051594.1.2674 WP_001051594.1.26749 WP_001051594.1.26751 WP_001051594.1.26771 WP_001051594.1.26772 WP_001051594.1.26790 WP_001051594.1.26804 WP_001051594.1.2684 WP_001051594.1.26840 WP_001051594.1.26850 WP_001051594.1.26865 WP_001051594.1.2687 WP_001051594.1.26884 WP_001051594.1.2689 WP_001051594.1.26903 WP_001051594.1.26905 WP_001051594.1.26927 WP_001051594.1.26938 WP_001051594.1.26944 WP_001051594.1.26958 WP_001051594.1.26963 WP_001051594.1.2697 WP_001051594.1.27013 WP_001051594.1.27042 WP_001051594.1.27053 WP_001051594.1.27083 WP_001051594.1.27154 WP_001051594.1.27166 WP_001051594.1.27168 WP_001051594.1.27170 WP_001051594.1.2718 WP_001051594.1.27182 WP_001051594.1.2719 WP_001051594.1.27207 WP_001051594.1.27237 WP_001051594.1.27246 WP_001051594.1.27262 WP_001051594.1.27293 WP_001051594.1.27294 WP_001051594.1.27311 WP_001051594.1.27323 WP_001051594.1.27333 WP_001051594.1.2734 WP_001051594.1.27345 WP_001051594.1.27379 WP_001051594.1.27387 WP_001051594.1.27447 WP_001051594.1.27448 WP_001051594.1.27455 WP_001051594.1.27456 WP_001051594.1.27457 WP_001051594.1.27467 WP_001051594.1.27468 WP_001051594.1.2753 WP_001051594.1.27539 WP_001051594.1.27551 WP_001051594.1.27562 WP_001051594.1.2759 WP_001051594.1.27590 WP_001051594.1.27608 WP_001051594.1.27614 WP_001051594.1.27615 WP_001051594.1.27621 WP_001051594.1.27628 WP_001051594.1.27640 WP_001051594.1.27646 WP_001051594.1.27654 WP_001051594.1.27670 WP_001051594.1.2768 WP_001051594.1.27689 WP_001051594.1.27696 WP_001051594.1.27717 WP_001051594.1.27739 WP_001051594.1.27744 WP_001051594.1.27748 WP_001051594.1.27765 WP_001051594.1.27787 WP_001051594.1.27793 WP_001051594.1.27799 WP_001051594.1.27817 WP_001051594.1.27830 WP_001051594.1.27854 WP_001051594.1.27929 WP_001051594.1.2795 WP_001051594.1.27950 WP_001051594.1.27953 WP_001051594.1.27972 WP_001051594.1.28007 WP_001051594.1.28016 WP_001051594.1.28025 WP_001051594.1.28063 WP_001051594.1.28071 WP_001051594.1.28079 WP_001051594.1.28088 WP_001051594.1.28091 WP_001051594.1.28105 WP_001051594.1.28117 WP_001051594.1.28138 WP_001051594.1.28147 WP_001051594.1.28158 WP_001051594.1.28173 WP_001051594.1.28191 WP_001051594.1.28207 WP_001051594.1.28213 WP_001051594.1.28226 WP_001051594.1.28230 WP_001051594.1.28253 WP_001051594.1.28257 WP_001051594.1.28274 WP_001051594.1.28315 WP_001051594.1.28319 WP_001051594.1.28334 WP_001051594.1.28347 WP_001051594.1.28358 WP_001051594.1.28360 WP_001051594.1.28376 WP_001051594.1.28381 WP_001051594.1.28399 WP_001051594.1.28400 WP_001051594.1.28430 WP_001051594.1.28447 WP_001051594.1.28477 WP_001051594.1.28482 WP_001051594.1.28498 WP_001051594.1.28502 WP_001051594.1.2852 WP_001051594.1.28527 WP_001051594.1.28532 WP_001051594.1.28564 WP_001051594.1.28578 WP_001051594.1.28580 WP_001051594.1.28584 WP_001051594.1.28605 WP_001051594.1.2862 WP_001051594.1.28629 WP_001051594.1.28650 WP_001051594.1.28652 WP_001051594.1.28675 WP_001051594.1.28710 WP_001051594.1.28720 WP_001051594.1.28725 WP_001051594.1.28763 WP_001051594.1.28784 WP_001051594.1.28785 WP_001051594.1.28848 WP_001051594.1.28862 WP_001051594.1.28871 WP_001051594.1.28887 WP_001051594.1.28909 WP_001051594.1.2891 WP_001051594.1.28925 WP_001051594.1.28933 WP_001051594.1.28960 WP_001051594.1.28970 WP_001051594.1.28981 WP_001051594.1.28987 WP_001051594.1.29052 WP_001051594.1.29060 WP_001051594.1.29090 WP_001051594.1.29107 WP_001051594.1.29112 WP_001051594.1.2913 WP_001051594.1.29155 WP_001051594.1.29166 WP_001051594.1.29187 WP_001051594.1.29188 WP_001051594.1.29207 WP_001051594.1.29226 WP_001051594.1.29242 WP_001051594.1.29243 WP_001051594.1.29244 WP_001051594.1.29263 WP_001051594.1.29272 WP_001051594.1.29276 WP_001051594.1.29282 WP_001051594.1.29285 WP_001051594.1.29312 WP_001051594.1.29366 WP_001051594.1.29368 WP_001051594.1.29372 WP_001051594.1.29373 WP_001051594.1.29381 WP_001051594.1.29395 WP_001051594.1.29420 WP_001051594.1.29468 WP_001051594.1.29511 WP_001051594.1.29541 WP_001051594.1.29553 WP_001051594.1.29557 WP_001051594.1.29561 WP_001051594.1.2957 WP_001051594.1.29596 WP_001051594.1.29644 WP_001051594.1.29676 WP_001051594.1.2972 WP_001051594.1.29731 WP_001051594.1.29736 WP_001051594.1.29744 WP_001051594.1.2975 WP_001051594.1.29758 WP_001051594.1.29781 WP_001051594.1.29788 WP_001051594.1.29805 WP_001051594.1.2981 WP_001051594.1.29826 WP_001051594.1.2983 WP_001051594.1.29862 WP_001051594.1.29885 WP_001051594.1.29902 WP_001051594.1.29905 WP_001051594.1.29918 WP_001051594.1.29963 WP_001051594.1.2997 WP_001051594.1.29981 WP_001051594.1.29982 WP_001051594.1.30012 WP_001051594.1.30023 WP_001051594.1.30033 WP_001051594.1.30047 WP_001051594.1.30051 WP_001051594.1.30057 WP_001051594.1.30089 WP_001051594.1.30095 WP_001051594.1.30100 WP_001051594.1.30130 WP_001051594.1.30152 WP_001051594.1.30154 WP_001051594.1.30176 WP_001051594.1.30186 WP_001051594.1.30191 WP_001051594.1.30197 WP_001051594.1.30209 WP_001051594.1.30249 WP_001051594.1.30268 WP_001051594.1.30274 WP_001051594.1.30307 WP_001051594.1.30328 WP_001051594.1.30364 WP_001051594.1.30367 WP_001051594.1.30376 WP_001051594.1.30381 WP_001051594.1.30385 WP_001051594.1.30418 WP_001051594.1.30422 WP_001051594.1.30477 WP_001051594.1.30508 WP_001051594.1.30530 WP_001051594.1.30531 WP_001051594.1.30560 WP_001051594.1.30566 WP_001051594.1.30622 WP_001051594.1.30623 WP_001051594.1.30645 WP_001051594.1.30646 WP_001051594.1.30648 WP_001051594.1.30652 WP_001051594.1.30666 WP_001051594.1.30702 WP_001051594.1.30726 WP_001051594.1.30758 WP_001051594.1.30763 WP_001051594.1.3077 WP_001051594.1.30779 WP_001051594.1.30854 WP_001051594.1.30862 WP_001051594.1.30863 WP_001051594.1.30874 WP_001051594.1.30878 WP_001051594.1.30889 WP_001051594.1.30907 WP_001051594.1.30911 WP_001051594.1.30915 WP_001051594.1.30916 WP_001051594.1.30928 WP_001051594.1.3097 WP_001051594.1.30970 WP_001051594.1.30971 WP_001051594.1.30998 WP_001051594.1.31005 WP_001051594.1.31022 WP_001051594.1.31037 WP_001051594.1.31039 WP_001051594.1.31048 WP_001051594.1.31065 WP_001051594.1.31068 WP_001051594.1.31077 WP_001051594.1.31091 WP_001051594.1.31113 WP_001051594.1.31120 WP_001051594.1.31124 WP_001051594.1.31176 WP_001051594.1.31194 WP_001051594.1.31204 WP_001051594.1.31206 WP_001051594.1.3123 WP_001051594.1.31232 WP_001051594.1.31315 WP_001051594.1.3132 WP_001051594.1.31337 WP_001051594.1.31339 WP_001051594.1.31355 WP_001051594.1.31376 WP_001051594.1.31436 WP_001051594.1.31437 WP_001051594.1.31441 WP_001051594.1.31442 WP_001051594.1.31462 WP_001051594.1.31468 WP_001051594.1.31478 WP_001051594.1.31479 WP_001051594.1.31497 WP_001051594.1.315 WP_001051594.1.31529 WP_001051594.1.31539 WP_001051594.1.31567 WP_001051594.1.31568 WP_001051594.1.31589 WP_001051594.1.31605 WP_001051594.1.31611 WP_001051594.1.31621 WP_001051594.1.31638 WP_001051594.1.31642 WP_001051594.1.31647 WP_001051594.1.31653 WP_001051594.1.31667 WP_001051594.1.31686 WP_001051594.1.31701 WP_001051594.1.31743 WP_001051594.1.31753 WP_001051594.1.31787 WP_001051594.1.31797 WP_001051594.1.31817 WP_001051594.1.31827 WP_001051594.1.31828 WP_001051594.1.31842 WP_001051594.1.31892 WP_001051594.1.31897 WP_001051594.1.31925 WP_001051594.1.31931 WP_001051594.1.31949 WP_001051594.1.31990 WP_001051594.1.31994 WP_001051594.1.31997 WP_001051594.1.32003 WP_001051594.1.32005 WP_001051594.1.32029 WP_001051594.1.32040 WP_001051594.1.32059 WP_001051594.1.32067 WP_001051594.1.32077 WP_001051594.1.32118 WP_001051594.1.32122 WP_001051594.1.32130 WP_001051594.1.32160 WP_001051594.1.32167 WP_001051594.1.32207 WP_001051594.1.32217 WP_001051594.1.32244 WP_001051594.1.32248 WP_001051594.1.32281 WP_001051594.1.3229 WP_001051594.1.32295 WP_001051594.1.3231 WP_001051594.1.32339 WP_001051594.1.32365 WP_001051594.1.32384 WP_001051594.1.32405 WP_001051594.1.3242 WP_001051594.1.3244 WP_001051594.1.32454 WP_001051594.1.32464 WP_001051594.1.32474 WP_001051594.1.32481 WP_001051594.1.32483 WP_001051594.1.32514 WP_001051594.1.32534 WP_001051594.1.32555 WP_001051594.1.32565 WP_001051594.1.32599 WP_001051594.1.32607 WP_001051594.1.32634 WP_001051594.1.32645 WP_001051594.1.32739 WP_001051594.1.32746 WP_001051594.1.32763 WP_001051594.1.32764 WP_001051594.1.32770 WP_001051594.1.32800 WP_001051594.1.32829 WP_001051594.1.32839 WP_001051594.1.32921 WP_001051594.1.32928 WP_001051594.1.32939 WP_001051594.1.32954 WP_001051594.1.32987 WP_001051594.1.3299 WP_001051594.1.33038 WP_001051594.1.33048 WP_001051594.1.3306 WP_001051594.1.33067 WP_001051594.1.33108 WP_001051594.1.33110 WP_001051594.1.33123 WP_001051594.1.33138 WP_001051594.1.33147 WP_001051594.1.3316 WP_001051594.1.33172 WP_001051594.1.33212 WP_001051594.1.33213 WP_001051594.1.33250 WP_001051594.1.33252 WP_001051594.1.33255 WP_001051594.1.33266 WP_001051594.1.33292 WP_001051594.1.33296 WP_001051594.1.3330 WP_001051594.1.33307 WP_001051594.1.33322 WP_001051594.1.33328 WP_001051594.1.33335 WP_001051594.1.3335 WP_001051594.1.33350 WP_001051594.1.33357 WP_001051594.1.33372 WP_001051594.1.3338 WP_001051594.1.33388 WP_001051594.1.33394 WP_001051594.1.3341 WP_001051594.1.33416 WP_001051594.1.3342 WP_001051594.1.33426 WP_001051594.1.3343 WP_001051594.1.33432 WP_001051594.1.3345 WP_001051594.1.33463 WP_001051594.1.33468 WP_001051594.1.3347 WP_001051594.1.33483 WP_001051594.1.33484 WP_001051594.1.33507 WP_001051594.1.33520 WP_001051594.1.33567 WP_001051594.1.33575 WP_001051594.1.33594 WP_001051594.1.33607 WP_001051594.1.33626 WP_001051594.1.33627 WP_001051594.1.3363 WP_001051594.1.33640 WP_001051594.1.33650 WP_001051594.1.33654 WP_001051594.1.33655 WP_001051594.1.33692 WP_001051594.1.33695 WP_001051594.1.33707 WP_001051594.1.33718 WP_001051594.1.33724 WP_001051594.1.33735 WP_001051594.1.33737 WP_001051594.1.33743 WP_001051594.1.33756 WP_001051594.1.33766 WP_001051594.1.33767 WP_001051594.1.33769 WP_001051594.1.33778 WP_001051594.1.33792 WP_001051594.1.33804 WP_001051594.1.33813 WP_001051594.1.33850 WP_001051594.1.33899 WP_001051594.1.33940 WP_001051594.1.33949 WP_001051594.1.33966 WP_001051594.1.33968 WP_001051594.1.33971 WP_001051594.1.33983 WP_001051594.1.33994 WP_001051594.1.34026 WP_001051594.1.34030 WP_001051594.1.34051 WP_001051594.1.34060 WP_001051594.1.34062 WP_001051594.1.34069 WP_001051594.1.34078 WP_001051594.1.34080 WP_001051594.1.34100 WP_001051594.1.34105 WP_001051594.1.34112 WP_001051594.1.34132 WP_001051594.1.3418 WP_001051594.1.34182 WP_001051594.1.34209 WP_001051594.1.34244 WP_001051594.1.34250 WP_001051594.1.34251 WP_001051594.1.34254 WP_001051594.1.34280 WP_001051594.1.34285 WP_001051594.1.34361 WP_001051594.1.34381 WP_001051594.1.34403 WP_001051594.1.34410 WP_001051594.1.3442 WP_001051594.1.34427 WP_001051594.1.34436 WP_001051594.1.34471 WP_001051594.1.3448 WP_001051594.1.34482 WP_001051594.1.34492 WP_001051594.1.34502 WP_001051594.1.34510 WP_001051594.1.34512 WP_001051594.1.34526 WP_001051594.1.3461 WP_001051594.1.34620 WP_001051594.1.34677 WP_001051594.1.34716 WP_001051594.1.34723 WP_001051594.1.34733 WP_001051594.1.34737 WP_001051594.1.3474 WP_001051594.1.34741 WP_001051594.1.34767 WP_001051594.1.34774 WP_001051594.1.34818 WP_001051594.1.34847 WP_001051594.1.34865 WP_001051594.1.34890 WP_001051594.1.34912 WP_001051594.1.34918 WP_001051594.1.34923 WP_001051594.1.34926 WP_001051594.1.34943 WP_001051594.1.34967 WP_001051594.1.34998 WP_001051594.1.35031 WP_001051594.1.35032 WP_001051594.1.35059 WP_001051594.1.35062 WP_001051594.1.35089 WP_001051594.1.35097 WP_001051594.1.35110 WP_001051594.1.35121 WP_001051594.1.35182 WP_001051594.1.35194 WP_001051594.1.35233 WP_001051594.1.35276 WP_001051594.1.35285 WP_001051594.1.35289 WP_001051594.1.35297 WP_001051594.1.35307 WP_001051594.1.35314 WP_001051594.1.35334 WP_001051594.1.35340 WP_001051594.1.35342 WP_001051594.1.35391 WP_001051594.1.354 WP_001051594.1.35413 WP_001051594.1.35415 WP_001051594.1.3542 WP_001051594.1.35423 WP_001051594.1.3547 WP_001051594.1.35498 WP_001051594.1.35506 WP_001051594.1.35508 WP_001051594.1.35517 WP_001051594.1.35519 WP_001051594.1.35525 WP_001051594.1.35549 WP_001051594.1.35580 WP_001051594.1.35615 WP_001051594.1.35623 WP_001051594.1.35642 WP_001051594.1.35661 WP_001051594.1.35686 WP_001051594.1.3569 WP_001051594.1.35696 WP_001051594.1.35730 WP_001051594.1.3574 WP_001051594.1.35742 WP_001051594.1.35784 WP_001051594.1.3579 WP_001051594.1.35801 WP_001051594.1.35826 WP_001051594.1.35837 WP_001051594.1.35888 WP_001051594.1.35890 WP_001051594.1.35900 WP_001051594.1.35928 WP_001051594.1.35950 WP_001051594.1.36004 WP_001051594.1.36041 WP_001051594.1.36082 WP_001051594.1.36093 WP_001051594.1.36102 WP_001051594.1.3611 WP_001051594.1.36119 WP_001051594.1.36141 WP_001051594.1.3617 WP_001051594.1.36176 WP_001051594.1.36179 WP_001051594.1.36187 WP_001051594.1.36188 WP_001051594.1.36208 WP_001051594.1.36249 WP_001051594.1.36250 WP_001051594.1.36264 WP_001051594.1.36278 WP_001051594.1.36282 WP_001051594.1.36302 WP_001051594.1.36307 WP_001051594.1.36344 WP_001051594.1.36389 WP_001051594.1.36430 WP_001051594.1.36434 WP_001051594.1.36439 WP_001051594.1.36532 WP_001051594.1.36535 WP_001051594.1.3655 WP_001051594.1.36570 WP_001051594.1.36580 WP_001051594.1.36600 WP_001051594.1.36615 WP_001051594.1.36640 WP_001051594.1.36646 WP_001051594.1.3666 WP_001051594.1.36669 WP_001051594.1.36689 WP_001051594.1.36697 WP_001051594.1.36698 WP_001051594.1.36704 WP_001051594.1.36729 WP_001051594.1.3675 WP_001051594.1.36754 WP_001051594.1.36773 WP_001051594.1.36783 WP_001051594.1.36796 WP_001051594.1.36797 WP_001051594.1.36814 WP_001051594.1.36822 WP_001051594.1.36823 WP_001051594.1.36847 WP_001051594.1.3685 WP_001051594.1.36858 WP_001051594.1.3687 WP_001051594.1.36888 WP_001051594.1.3690 WP_001051594.1.36903 WP_001051594.1.36911 WP_001051594.1.36955 WP_001051594.1.36979 WP_001051594.1.36980 WP_001051594.1.36997 WP_001051594.1.37002 WP_001051594.1.37016 WP_001051594.1.3703 WP_001051594.1.37044 WP_001051594.1.37045 WP_001051594.1.37055 WP_001051594.1.37075 WP_001051594.1.37080 WP_001051594.1.3709 WP_001051594.1.37120 WP_001051594.1.37121 WP_001051594.1.37130 WP_001051594.1.37134 WP_001051594.1.37145 WP_001051594.1.37159 WP_001051594.1.3718 WP_001051594.1.3719 WP_001051594.1.3722 WP_001051594.1.37220 WP_001051594.1.37240 WP_001051594.1.37335 WP_001051594.1.37341 WP_001051594.1.37378 WP_001051594.1.37398 WP_001051594.1.37411 WP_001051594.1.37424 WP_001051594.1.37435 WP_001051594.1.37467 WP_001051594.1.37503 WP_001051594.1.37546 WP_001051594.1.37583 WP_001051594.1.37602 WP_001051594.1.37605 WP_001051594.1.37606 WP_001051594.1.37621 WP_001051594.1.37624 WP_001051594.1.37644 WP_001051594.1.37669 WP_001051594.1.37679 WP_001051594.1.3774 WP_001051594.1.37749 WP_001051594.1.3776 WP_001051594.1.37764 WP_001051594.1.37771 WP_001051594.1.37781 WP_001051594.1.37788 WP_001051594.1.37815 WP_001051594.1.37828 WP_001051594.1.37851 WP_001051594.1.37855 WP_001051594.1.37866 WP_001051594.1.37875 WP_001051594.1.37891 WP_001051594.1.37906 WP_001051594.1.37907 WP_001051594.1.37929 WP_001051594.1.37953 WP_001051594.1.37987 WP_001051594.1.38030 WP_001051594.1.38034 WP_001051594.1.38038 WP_001051594.1.38057 WP_001051594.1.38070 WP_001051594.1.38082 WP_001051594.1.3809 WP_001051594.1.38111 WP_001051594.1.38128 WP_001051594.1.38136 WP_001051594.1.38160 WP_001051594.1.3817 WP_001051594.1.38177 WP_001051594.1.3820 WP_001051594.1.38222 WP_001051594.1.38230 WP_001051594.1.38232 WP_001051594.1.38276 WP_001051594.1.38282 WP_001051594.1.38304 WP_001051594.1.38309 WP_001051594.1.38339 WP_001051594.1.38383 WP_001051594.1.3842 WP_001051594.1.38422 WP_001051594.1.38435 WP_001051594.1.38437 WP_001051594.1.38453 WP_001051594.1.38516 WP_001051594.1.38522 WP_001051594.1.38546 WP_001051594.1.38555 WP_001051594.1.38557 WP_001051594.1.38607 WP_001051594.1.38612 WP_001051594.1.38637 WP_001051594.1.3867 WP_001051594.1.38674 WP_001051594.1.38688 WP_001051594.1.38721 WP_001051594.1.3875 WP_001051594.1.38760 WP_001051594.1.38786 WP_001051594.1.38823 WP_001051594.1.38841 WP_001051594.1.38858 WP_001051594.1.38875 WP_001051594.1.38885 WP_001051594.1.38890 WP_001051594.1.38926 WP_001051594.1.38927 WP_001051594.1.38931 WP_001051594.1.38941 WP_001051594.1.38943 WP_001051594.1.38972 WP_001051594.1.38979 WP_001051594.1.38989 WP_001051594.1.390 WP_001051594.1.39012 WP_001051594.1.39014 WP_001051594.1.39017 WP_001051594.1.39026 WP_001051594.1.39043 WP_001051594.1.39053 WP_001051594.1.3906 WP_001051594.1.391 WP_001051594.1.39108 WP_001051594.1.39126 WP_001051594.1.39166 WP_001051594.1.39203 WP_001051594.1.39206 WP_001051594.1.39217 WP_001051594.1.39241 WP_001051594.1.3926 WP_001051594.1.39272 WP_001051594.1.39285 WP_001051594.1.39290 WP_001051594.1.39324 WP_001051594.1.39330 WP_001051594.1.39332 WP_001051594.1.39333 WP_001051594.1.39361 WP_001051594.1.39378 WP_001051594.1.39384 WP_001051594.1.39397 WP_001051594.1.39406 WP_001051594.1.39432 WP_001051594.1.39451 WP_001051594.1.39486 WP_001051594.1.39494 WP_001051594.1.39499 WP_001051594.1.39506 WP_001051594.1.39519 WP_001051594.1.39542 WP_001051594.1.39550 WP_001051594.1.39613 WP_001051594.1.39642 WP_001051594.1.39645 WP_001051594.1.39670 WP_001051594.1.39671 WP_001051594.1.39682 WP_001051594.1.39687 WP_001051594.1.39689 WP_001051594.1.39693 WP_001051594.1.39697 WP_001051594.1.39711 WP_001051594.1.39738 WP_001051594.1.39767 WP_001051594.1.39789 WP_001051594.1.39832 WP_001051594.1.39838 WP_001051594.1.39856 WP_001051594.1.39857 WP_001051594.1.39869 WP_001051594.1.39943 WP_001051594.1.39995 WP_001051594.1.40014 WP_001051594.1.40043 WP_001051594.1.40076 WP_001051594.1.40082 WP_001051594.1.40099 WP_001051594.1.4010 WP_001051594.1.40120 WP_001051594.1.40137 WP_001051594.1.40149 WP_001051594.1.4015 WP_001051594.1.40161 WP_001051594.1.40164 WP_001051594.1.4019 WP_001051594.1.40247 WP_001051594.1.40318 WP_001051594.1.40320 WP_001051594.1.40329 WP_001051594.1.40330 WP_001051594.1.40340 WP_001051594.1.40342 WP_001051594.1.40368 WP_001051594.1.40369 WP_001051594.1.40406 WP_001051594.1.40409 WP_001051594.1.40428 WP_001051594.1.4045 WP_001051594.1.40472 WP_001051594.1.40474 WP_001051594.1.40481 WP_001051594.1.40500 WP_001051594.1.40505 WP_001051594.1.40531 WP_001051594.1.40532 WP_001051594.1.40554 WP_001051594.1.4056 WP_001051594.1.40579 WP_001051594.1.40588 WP_001051594.1.40620 WP_001051594.1.40644 WP_001051594.1.40655 WP_001051594.1.40658 WP_001051594.1.40659 WP_001051594.1.40670 WP_001051594.1.40700 WP_001051594.1.40719 WP_001051594.1.40729 WP_001051594.1.40760 WP_001051594.1.4078 WP_001051594.1.40780 WP_001051594.1.40797 WP_001051594.1.40814 WP_001051594.1.40816 WP_001051594.1.40939 WP_001051594.1.40997 WP_001051594.1.41011 WP_001051594.1.41033 WP_001051594.1.41038 WP_001051594.1.4105 WP_001051594.1.41058 WP_001051594.1.41064 WP_001051594.1.41066 WP_001051594.1.41084 WP_001051594.1.41094 WP_001051594.1.41104 WP_001051594.1.41119 WP_001051594.1.41129 WP_001051594.1.41133 WP_001051594.1.4115 WP_001051594.1.41178 WP_001051594.1.412 WP_001051594.1.41208 WP_001051594.1.41241 WP_001051594.1.41289 WP_001051594.1.4129 WP_001051594.1.41350 WP_001051594.1.41374 WP_001051594.1.41386 WP_001051594.1.41389 WP_001051594.1.41426 WP_001051594.1.41432 WP_001051594.1.41433 WP_001051594.1.4144 WP_001051594.1.41458 WP_001051594.1.41499 WP_001051594.1.41511 WP_001051594.1.41532 WP_001051594.1.41533 WP_001051594.1.41555 WP_001051594.1.41558 WP_001051594.1.41567 WP_001051594.1.41581 WP_001051594.1.41582 WP_001051594.1.41587 WP_001051594.1.41598 WP_001051594.1.41612 WP_001051594.1.41620 WP_001051594.1.41623 WP_001051594.1.41674 WP_001051594.1.41681 WP_001051594.1.4169 WP_001051594.1.41743 WP_001051594.1.41755 WP_001051594.1.41796 WP_001051594.1.41817 WP_001051594.1.4182 WP_001051594.1.41839 WP_001051594.1.41863 WP_001051594.1.4188 WP_001051594.1.41891 WP_001051594.1.41898 WP_001051594.1.41935 WP_001051594.1.41943 WP_001051594.1.41972 WP_001051594.1.41983 WP_001051594.1.41989 WP_001051594.1.420 WP_001051594.1.42001 WP_001051594.1.42003 WP_001051594.1.42015 WP_001051594.1.42017 WP_001051594.1.4202 WP_001051594.1.42028 WP_001051594.1.42056 WP_001051594.1.42064 WP_001051594.1.42072 WP_001051594.1.42085 WP_001051594.1.42087 WP_001051594.1.42125 WP_001051594.1.42137 WP_001051594.1.42169 WP_001051594.1.42178 WP_001051594.1.42198 WP_001051594.1.42230 WP_001051594.1.42241 WP_001051594.1.4225 WP_001051594.1.42269 WP_001051594.1.42286 WP_001051594.1.42298 WP_001051594.1.42305 WP_001051594.1.42325 WP_001051594.1.42344 WP_001051594.1.42355 WP_001051594.1.42403 WP_001051594.1.42436 WP_001051594.1.42459 WP_001051594.1.42460 WP_001051594.1.42481 WP_001051594.1.42510 WP_001051594.1.42551 WP_001051594.1.42593 WP_001051594.1.426 WP_001051594.1.42607 WP_001051594.1.42640 WP_001051594.1.42652 WP_001051594.1.42668 WP_001051594.1.42674 WP_001051594.1.42679 WP_001051594.1.42681 WP_001051594.1.42733 WP_001051594.1.42737 WP_001051594.1.42740 WP_001051594.1.42759 WP_001051594.1.42764 WP_001051594.1.42786 WP_001051594.1.42788 WP_001051594.1.42798 WP_001051594.1.42816 WP_001051594.1.42837 WP_001051594.1.42848 WP_001051594.1.42883 WP_001051594.1.42897 WP_001051594.1.42907 WP_001051594.1.42925 WP_001051594.1.4293 WP_001051594.1.42959 WP_001051594.1.42984 WP_001051594.1.42985 WP_001051594.1.4299 WP_001051594.1.42990 WP_001051594.1.43014 WP_001051594.1.43023 WP_001051594.1.43047 WP_001051594.1.43061 WP_001051594.1.43072 WP_001051594.1.43095 WP_001051594.1.43110 WP_001051594.1.43122 WP_001051594.1.43125 WP_001051594.1.43131 WP_001051594.1.43134 WP_001051594.1.43139 WP_001051594.1.43143 WP_001051594.1.43147 WP_001051594.1.43159 WP_001051594.1.43165 WP_001051594.1.43168 WP_001051594.1.43179 WP_001051594.1.43200 WP_001051594.1.43202 WP_001051594.1.43204 WP_001051594.1.43206 WP_001051594.1.43232 WP_001051594.1.43248 WP_001051594.1.4325 WP_001051594.1.43252 WP_001051594.1.43263 WP_001051594.1.4327 WP_001051594.1.43274 WP_001051594.1.43279 WP_001051594.1.43323 WP_001051594.1.43341 WP_001051594.1.43349 WP_001051594.1.43360 WP_001051594.1.43369 WP_001051594.1.4337 WP_001051594.1.43375 WP_001051594.1.43405 WP_001051594.1.43406 WP_001051594.1.4341 WP_001051594.1.43446 WP_001051594.1.43460 WP_001051594.1.43506 WP_001051594.1.43512 WP_001051594.1.43550 WP_001051594.1.43560 WP_001051594.1.43617 WP_001051594.1.43618 WP_001051594.1.43627 WP_001051594.1.43659 WP_001051594.1.43665 WP_001051594.1.43670 WP_001051594.1.43693 WP_001051594.1.43702 WP_001051594.1.43703 WP_001051594.1.4372 WP_001051594.1.43731 WP_001051594.1.43752 WP_001051594.1.43784 WP_001051594.1.43788 WP_001051594.1.43819 WP_001051594.1.43827 WP_001051594.1.4385 WP_001051594.1.43851 WP_001051594.1.4386 WP_001051594.1.43904 WP_001051594.1.43915 WP_001051594.1.43964 WP_001051594.1.43984 WP_001051594.1.43995 WP_001051594.1.44074 WP_001051594.1.44095 WP_001051594.1.44119 WP_001051594.1.44153 WP_001051594.1.44177 WP_001051594.1.44178 WP_001051594.1.44181 WP_001051594.1.44195 WP_001051594.1.44265 WP_001051594.1.44302 WP_001051594.1.44331 WP_001051594.1.44344 WP_001051594.1.44382 WP_001051594.1.44388 WP_001051594.1.44396 WP_001051594.1.44405 WP_001051594.1.44420 WP_001051594.1.44432 WP_001051594.1.44504 WP_001051594.1.44515 WP_001051594.1.44517 WP_001051594.1.44520 WP_001051594.1.44536 WP_001051594.1.44544 WP_001051594.1.44579 WP_001051594.1.44586 WP_001051594.1.44588 WP_001051594.1.44605 WP_001051594.1.44623 WP_001051594.1.44631 WP_001051594.1.44655 WP_001051594.1.44667 WP_001051594.1.44672 WP_001051594.1.447 WP_001051594.1.44714 WP_001051594.1.44715 WP_001051594.1.44732 WP_001051594.1.44755 WP_001051594.1.44780 WP_001051594.1.44785 WP_001051594.1.44788 WP_001051594.1.44796 WP_001051594.1.44856 WP_001051594.1.44868 WP_001051594.1.44881 WP_001051594.1.44882 WP_001051594.1.44892 WP_001051594.1.44914 WP_001051594.1.44940 WP_001051594.1.44955 WP_001051594.1.44969 WP_001051594.1.4499 WP_001051594.1.44993 WP_001051594.1.45008 WP_001051594.1.45033 WP_001051594.1.45035 WP_001051594.1.45042 WP_001051594.1.45050 WP_001051594.1.45080 WP_001051594.1.45091 WP_001051594.1.45094 WP_001051594.1.45099 WP_001051594.1.45114 WP_001051594.1.4513 WP_001051594.1.45133 WP_001051594.1.45140 WP_001051594.1.45157 WP_001051594.1.45162 WP_001051594.1.45164 WP_001051594.1.45170 WP_001051594.1.45221 WP_001051594.1.45223 WP_001051594.1.45242 WP_001051594.1.45267 WP_001051594.1.4527 WP_001051594.1.45272 WP_001051594.1.45281 WP_001051594.1.45290 WP_001051594.1.45297 WP_001051594.1.453 WP_001051594.1.45364 WP_001051594.1.45419 WP_001051594.1.45431 WP_001051594.1.45439 WP_001051594.1.4545 WP_001051594.1.45450 WP_001051594.1.45456 WP_001051594.1.4546 WP_001051594.1.45472 WP_001051594.1.45492 WP_001051594.1.4550 WP_001051594.1.45507 WP_001051594.1.45542 WP_001051594.1.45555 WP_001051594.1.45560 WP_001051594.1.45574 WP_001051594.1.45577 WP_001051594.1.45610 WP_001051594.1.45645 WP_001051594.1.45654 WP_001051594.1.45670 WP_001051594.1.45703 WP_001051594.1.45705 WP_001051594.1.45730 WP_001051594.1.45734 WP_001051594.1.45763 WP_001051594.1.45768 WP_001051594.1.4577 WP_001051594.1.45771 WP_001051594.1.45773 WP_001051594.1.45780 WP_001051594.1.45833 WP_001051594.1.4584 WP_001051594.1.45852 WP_001051594.1.45859 WP_001051594.1.45862 WP_001051594.1.45874 WP_001051594.1.45878 WP_001051594.1.45897 WP_001051594.1.45954 WP_001051594.1.4597 WP_001051594.1.45972 WP_001051594.1.45977 WP_001051594.1.45979 WP_001051594.1.4598 WP_001051594.1.46003 WP_001051594.1.46005 WP_001051594.1.46013 WP_001051594.1.46021 WP_001051594.1.46035 WP_001051594.1.46037 WP_001051594.1.46050 WP_001051594.1.46055 WP_001051594.1.46062 WP_001051594.1.46078 WP_001051594.1.46087 WP_001051594.1.46109 WP_001051594.1.46168 WP_001051594.1.46171 WP_001051594.1.46172 WP_001051594.1.46208 WP_001051594.1.46222 WP_001051594.1.46228 WP_001051594.1.46248 WP_001051594.1.46259 WP_001051594.1.46276 WP_001051594.1.46289 WP_001051594.1.46330 WP_001051594.1.46333 WP_001051594.1.46334 WP_001051594.1.46339 WP_001051594.1.46353 WP_001051594.1.46362 WP_001051594.1.46368 WP_001051594.1.46380 WP_001051594.1.46389 WP_001051594.1.46401 WP_001051594.1.46422 WP_001051594.1.46465 WP_001051594.1.46529 WP_001051594.1.46543 WP_001051594.1.46587 WP_001051594.1.46619 WP_001051594.1.4662 WP_001051594.1.46648 WP_001051594.1.46660 WP_001051594.1.46664 WP_001051594.1.46670 WP_001051594.1.46676 WP_001051594.1.46692 WP_001051594.1.46702 WP_001051594.1.46703 WP_001051594.1.46720 WP_001051594.1.46736 WP_001051594.1.46752 WP_001051594.1.46765 WP_001051594.1.46770 WP_001051594.1.4680 WP_001051594.1.46852 WP_001051594.1.46881 WP_001051594.1.46906 WP_001051594.1.46908 WP_001051594.1.46914 WP_001051594.1.46925 WP_001051594.1.46929 WP_001051594.1.4694 WP_001051594.1.46947 WP_001051594.1.4696 WP_001051594.1.46983 WP_001051594.1.46995 WP_001051594.1.47002 WP_001051594.1.47051 WP_001051594.1.47065 WP_001051594.1.47105 WP_001051594.1.47107 WP_001051594.1.47111 WP_001051594.1.47128 WP_001051594.1.47153 WP_001051594.1.47159 WP_001051594.1.47163 WP_001051594.1.47175 WP_001051594.1.47187 WP_001051594.1.47193 WP_001051594.1.47211 WP_001051594.1.47216 WP_001051594.1.47258 WP_001051594.1.47269 WP_001051594.1.47279 WP_001051594.1.4728 WP_001051594.1.47282 WP_001051594.1.47290 WP_001051594.1.47294 WP_001051594.1.47306 WP_001051594.1.47328 WP_001051594.1.47331 WP_001051594.1.47334 WP_001051594.1.47381 WP_001051594.1.47399 WP_001051594.1.47406 WP_001051594.1.47408 WP_001051594.1.47426 WP_001051594.1.47439 WP_001051594.1.47459 WP_001051594.1.47522 WP_001051594.1.47560 WP_001051594.1.47617 WP_001051594.1.47618 WP_001051594.1.47669 WP_001051594.1.4767 WP_001051594.1.47680 WP_001051594.1.477 WP_001051594.1.47702 WP_001051594.1.47719 WP_001051594.1.47733 WP_001051594.1.47747 WP_001051594.1.47763 WP_001051594.1.47782 WP_001051594.1.47835 WP_001051594.1.47836 WP_001051594.1.47859 WP_001051594.1.47864 WP_001051594.1.47872 WP_001051594.1.47873 WP_001051594.1.47904 WP_001051594.1.47908 WP_001051594.1.4792 WP_001051594.1.47996 WP_001051594.1.48011 WP_001051594.1.48030 WP_001051594.1.48046 WP_001051594.1.48047 WP_001051594.1.4805 WP_001051594.1.48057 WP_001051594.1.48064 WP_001051594.1.48067 WP_001051594.1.48116 WP_001051594.1.48142 WP_001051594.1.48149 WP_001051594.1.4815 WP_001051594.1.48154 WP_001051594.1.48156 WP_001051594.1.48169 WP_001051594.1.48186 WP_001051594.1.48187 WP_001051594.1.48223 WP_001051594.1.48227 WP_001051594.1.48236 WP_001051594.1.48250 WP_001051594.1.48272 WP_001051594.1.48282 WP_001051594.1.48284 WP_001051594.1.48293 WP_001051594.1.48307 WP_001051594.1.48310 WP_001051594.1.48322 WP_001051594.1.48335 WP_001051594.1.48338 WP_001051594.1.48376 WP_001051594.1.48391 WP_001051594.1.48394 WP_001051594.1.48398 WP_001051594.1.4840 WP_001051594.1.48427 WP_001051594.1.48437 WP_001051594.1.48438 WP_001051594.1.48463 WP_001051594.1.48479 WP_001051594.1.4852 WP_001051594.1.48563 WP_001051594.1.48577 WP_001051594.1.48580 WP_001051594.1.48593 WP_001051594.1.48634 WP_001051594.1.48656 WP_001051594.1.48664 WP_001051594.1.48670 WP_001051594.1.4868 WP_001051594.1.48705 WP_001051594.1.48711 WP_001051594.1.48723 WP_001051594.1.48769 WP_001051594.1.48775 WP_001051594.1.48782 WP_001051594.1.48805 WP_001051594.1.48818 WP_001051594.1.48823 WP_001051594.1.48833 WP_001051594.1.48835 WP_001051594.1.4886 WP_001051594.1.48869 WP_001051594.1.48936 WP_001051594.1.48941 WP_001051594.1.48945 WP_001051594.1.48951 WP_001051594.1.48966 WP_001051594.1.48968 WP_001051594.1.48982 WP_001051594.1.48993 WP_001051594.1.4901 WP_001051594.1.49018 WP_001051594.1.4905 WP_001051594.1.49071 WP_001051594.1.49094 WP_001051594.1.49105 WP_001051594.1.49128 WP_001051594.1.49129 WP_001051594.1.49154 WP_001051594.1.49159 WP_001051594.1.4916 WP_001051594.1.49161 WP_001051594.1.4917 WP_001051594.1.49171 WP_001051594.1.49173 WP_001051594.1.4918 WP_001051594.1.49189 WP_001051594.1.49196 WP_001051594.1.49199 WP_001051594.1.49207 WP_001051594.1.49234 WP_001051594.1.4924 WP_001051594.1.49248 WP_001051594.1.49257 WP_001051594.1.49301 WP_001051594.1.49326 WP_001051594.1.49327 WP_001051594.1.49330 WP_001051594.1.49362 WP_001051594.1.49398 WP_001051594.1.49418 WP_001051594.1.49444 WP_001051594.1.4945 WP_001051594.1.4950 WP_001051594.1.49518 WP_001051594.1.49530 WP_001051594.1.49539 WP_001051594.1.49549 WP_001051594.1.49581 WP_001051594.1.49582 WP_001051594.1.496 WP_001051594.1.49603 WP_001051594.1.4962 WP_001051594.1.49643 WP_001051594.1.49653 WP_001051594.1.49669 WP_001051594.1.49672 WP_001051594.1.49690 WP_001051594.1.49715 WP_001051594.1.49728 WP_001051594.1.49730 WP_001051594.1.49732 WP_001051594.1.49742 WP_001051594.1.49745 WP_001051594.1.4980 WP_001051594.1.49800 WP_001051594.1.49819 WP_001051594.1.4982 WP_001051594.1.49860 WP_001051594.1.49871 WP_001051594.1.4989 WP_001051594.1.49894 WP_001051594.1.49907 WP_001051594.1.49918 WP_001051594.1.49934 WP_001051594.1.49935 WP_001051594.1.49936 WP_001051594.1.4994 WP_001051594.1.49970 WP_001051594.1.49982 WP_001051594.1.50013 WP_001051594.1.50015 WP_001051594.1.50028 WP_001051594.1.50038 WP_001051594.1.50061 WP_001051594.1.50076 WP_001051594.1.50117 WP_001051594.1.5013 WP_001051594.1.50138 WP_001051594.1.50145 WP_001051594.1.50178 WP_001051594.1.50192 WP_001051594.1.50217 WP_001051594.1.50219 WP_001051594.1.50229 WP_001051594.1.50261 WP_001051594.1.50291 WP_001051594.1.50313 WP_001051594.1.50314 WP_001051594.1.50356 WP_001051594.1.50360 WP_001051594.1.50367 WP_001051594.1.50369 WP_001051594.1.50388 WP_001051594.1.50425 WP_001051594.1.50430 WP_001051594.1.50431 WP_001051594.1.50464 WP_001051594.1.50516 WP_001051594.1.50525 WP_001051594.1.50536 WP_001051594.1.50555 WP_001051594.1.50556 WP_001051594.1.50558 WP_001051594.1.50578 WP_001051594.1.5059 WP_001051594.1.50594 WP_001051594.1.50595 WP_001051594.1.50647 WP_001051594.1.50660 WP_001051594.1.50669 WP_001051594.1.50699 WP_001051594.1.50740 WP_001051594.1.50759 WP_001051594.1.50768 WP_001051594.1.50799 WP_001051594.1.50817 WP_001051594.1.50820 WP_001051594.1.50829 WP_001051594.1.5087 WP_001051594.1.50884 WP_001051594.1.50896 WP_001051594.1.50937 WP_001051594.1.50962 WP_001051594.1.50974 WP_001051594.1.51008 WP_001051594.1.51015 WP_001051594.1.51062 WP_001051594.1.51085 WP_001051594.1.5109 WP_001051594.1.5110 WP_001051594.1.5111 WP_001051594.1.51130 WP_001051594.1.51138 WP_001051594.1.51152 WP_001051594.1.51209 WP_001051594.1.51226 WP_001051594.1.51236 WP_001051594.1.51245 WP_001051594.1.51250 WP_001051594.1.51271 WP_001051594.1.51277 WP_001051594.1.51282 WP_001051594.1.51295 WP_001051594.1.51306 WP_001051594.1.51310 WP_001051594.1.51326 WP_001051594.1.51346 WP_001051594.1.51365 WP_001051594.1.51376 WP_001051594.1.51393 WP_001051594.1.51403 WP_001051594.1.51454 WP_001051594.1.51456 WP_001051594.1.51492 WP_001051594.1.51496 WP_001051594.1.515 WP_001051594.1.51527 WP_001051594.1.51557 WP_001051594.1.51559 WP_001051594.1.51575 WP_001051594.1.51590 WP_001051594.1.51665 WP_001051594.1.51716 WP_001051594.1.51741 WP_001051594.1.51744 WP_001051594.1.51748 WP_001051594.1.51787 WP_001051594.1.51794 WP_001051594.1.51797 WP_001051594.1.51812 WP_001051594.1.51824 WP_001051594.1.51836 WP_001051594.1.51842 WP_001051594.1.5186 WP_001051594.1.51871 WP_001051594.1.51883 WP_001051594.1.51912 WP_001051594.1.51920 WP_001051594.1.51924 WP_001051594.1.51936 WP_001051594.1.51952 WP_001051594.1.51971 WP_001051594.1.51995 WP_001051594.1.52034 WP_001051594.1.52061 WP_001051594.1.52072 WP_001051594.1.52078 WP_001051594.1.521 WP_001051594.1.5213 WP_001051594.1.52151 WP_001051594.1.52162 WP_001051594.1.52182 WP_001051594.1.52185 WP_001051594.1.52193 WP_001051594.1.52195 WP_001051594.1.52198 WP_001051594.1.52210 WP_001051594.1.52251 WP_001051594.1.52252 WP_001051594.1.52259 WP_001051594.1.52289 WP_001051594.1.52296 WP_001051594.1.523 WP_001051594.1.52308 WP_001051594.1.5231 WP_001051594.1.52322 WP_001051594.1.52327 WP_001051594.1.52331 WP_001051594.1.52340 WP_001051594.1.52343 WP_001051594.1.52377 WP_001051594.1.52396 WP_001051594.1.52427 WP_001051594.1.52440 WP_001051594.1.52442 WP_001051594.1.52452 WP_001051594.1.52463 WP_001051594.1.5251 WP_001051594.1.52511 WP_001051594.1.52518 WP_001051594.1.52536 WP_001051594.1.52548 WP_001051594.1.52595 WP_001051594.1.52605 WP_001051594.1.52623 WP_001051594.1.52624 WP_001051594.1.52633 WP_001051594.1.52645 WP_001051594.1.52670 WP_001051594.1.52687 WP_001051594.1.52699 WP_001051594.1.52715 WP_001051594.1.52722 WP_001051594.1.52820 WP_001051594.1.52830 WP_001051594.1.52838 WP_001051594.1.52848 WP_001051594.1.52877 WP_001051594.1.52878 WP_001051594.1.52889 WP_001051594.1.52900 WP_001051594.1.52941 WP_001051594.1.52947 WP_001051594.1.52965 WP_001051594.1.52983 WP_001051594.1.52984 WP_001051594.1.53002 WP_001051594.1.5304 WP_001051594.1.53050 WP_001051594.1.53057 WP_001051594.1.53071 WP_001051594.1.53140 WP_001051594.1.53153 WP_001051594.1.53178 WP_001051594.1.5319 WP_001051594.1.53209 WP_001051594.1.53245 WP_001051594.1.53260 WP_001051594.1.53312 WP_001051594.1.53317 WP_001051594.1.53319 WP_001051594.1.53363 WP_001051594.1.53373 WP_001051594.1.53379 WP_001051594.1.53387 WP_001051594.1.53394 WP_001051594.1.53403 WP_001051594.1.53408 WP_001051594.1.53432 WP_001051594.1.53452 WP_001051594.1.53462 WP_001051594.1.53467 WP_001051594.1.5347 WP_001051594.1.53521 WP_001051594.1.53532 WP_001051594.1.53577 WP_001051594.1.53641 WP_001051594.1.53648 WP_001051594.1.53661 WP_001051594.1.53671 WP_001051594.1.53691 WP_001051594.1.53712 WP_001051594.1.53714 WP_001051594.1.53763 WP_001051594.1.53766 WP_001051594.1.53774 WP_001051594.1.53786 WP_001051594.1.53799 WP_001051594.1.53827 WP_001051594.1.53835 WP_001051594.1.53889 WP_001051594.1.53915 WP_001051594.1.53926 WP_001051594.1.53934 WP_001051594.1.53969 WP_001051594.1.53999 WP_001051594.1.5401 WP_001051594.1.54022 WP_001051594.1.54049 WP_001051594.1.54074 WP_001051594.1.54086 WP_001051594.1.54094 WP_001051594.1.54109 WP_001051594.1.54135 WP_001051594.1.54147 WP_001051594.1.54229 WP_001051594.1.54237 WP_001051594.1.54253 WP_001051594.1.54269 WP_001051594.1.54290 WP_001051594.1.54297 WP_001051594.1.54299 WP_001051594.1.54373 WP_001051594.1.54395 WP_001051594.1.544 WP_001051594.1.54404 WP_001051594.1.54413 WP_001051594.1.54438 WP_001051594.1.54471 WP_001051594.1.54477 WP_001051594.1.54479 WP_001051594.1.54485 WP_001051594.1.54491 WP_001051594.1.54503 WP_001051594.1.54510 WP_001051594.1.54543 WP_001051594.1.54551 WP_001051594.1.54554 WP_001051594.1.54574 WP_001051594.1.54637 WP_001051594.1.54675 WP_001051594.1.5469 WP_001051594.1.54744 WP_001051594.1.54745 WP_001051594.1.54753 WP_001051594.1.54830 WP_001051594.1.54847 WP_001051594.1.54851 WP_001051594.1.54878 WP_001051594.1.54914 WP_001051594.1.54929 WP_001051594.1.54931 WP_001051594.1.54955 WP_001051594.1.54967 WP_001051594.1.54990 WP_001051594.1.5500 WP_001051594.1.55004 WP_001051594.1.55014 WP_001051594.1.55058 WP_001051594.1.55082 WP_001051594.1.55084 WP_001051594.1.55090 WP_001051594.1.55095 WP_001051594.1.55139 WP_001051594.1.5518 WP_001051594.1.5519 WP_001051594.1.552 WP_001051594.1.55214 WP_001051594.1.55239 WP_001051594.1.55271 WP_001051594.1.55272 WP_001051594.1.55274 WP_001051594.1.55309 WP_001051594.1.55327 WP_001051594.1.55336 WP_001051594.1.5536 WP_001051594.1.55367 WP_001051594.1.55369 WP_001051594.1.55403 WP_001051594.1.55405 WP_001051594.1.55419 WP_001051594.1.55421 WP_001051594.1.55495 WP_001051594.1.5550 WP_001051594.1.55508 WP_001051594.1.55527 WP_001051594.1.55535 WP_001051594.1.5554 WP_001051594.1.55544 WP_001051594.1.55558 WP_001051594.1.5556 WP_001051594.1.55583 WP_001051594.1.5559 WP_001051594.1.55603 WP_001051594.1.5562 WP_001051594.1.55628 WP_001051594.1.55637 WP_001051594.1.5565 WP_001051594.1.55653 WP_001051594.1.557 WP_001051594.1.55717 WP_001051594.1.55719 WP_001051594.1.55724 WP_001051594.1.55728 WP_001051594.1.5575 WP_001051594.1.55784 WP_001051594.1.55786 WP_001051594.1.5580 WP_001051594.1.55818 WP_001051594.1.55831 WP_001051594.1.55835 WP_001051594.1.55839 WP_001051594.1.55845 WP_001051594.1.55859 WP_001051594.1.55867 WP_001051594.1.55886 WP_001051594.1.5589 WP_001051594.1.55904 WP_001051594.1.55916 WP_001051594.1.55933 WP_001051594.1.55949 WP_001051594.1.55955 WP_001051594.1.55985 WP_001051594.1.56000 WP_001051594.1.56003 WP_001051594.1.56025 WP_001051594.1.5604 WP_001051594.1.56048 WP_001051594.1.56064 WP_001051594.1.56098 WP_001051594.1.56099 WP_001051594.1.56106 WP_001051594.1.56135 WP_001051594.1.56159 WP_001051594.1.56200 WP_001051594.1.56210 WP_001051594.1.56213 WP_001051594.1.56225 WP_001051594.1.5623 WP_001051594.1.56237 WP_001051594.1.56239 WP_001051594.1.56260 WP_001051594.1.56265 WP_001051594.1.56272 WP_001051594.1.56275 WP_001051594.1.56281 WP_001051594.1.56332 WP_001051594.1.56333 WP_001051594.1.5635 WP_001051594.1.56364 WP_001051594.1.56387 WP_001051594.1.56400 WP_001051594.1.5644 WP_001051594.1.56464 WP_001051594.1.56482 WP_001051594.1.56522 WP_001051594.1.56527 WP_001051594.1.56542 WP_001051594.1.56558 WP_001051594.1.5658 WP_001051594.1.56584 WP_001051594.1.56598 WP_001051594.1.566 WP_001051594.1.56608 WP_001051594.1.56619 WP_001051594.1.56628 WP_001051594.1.56641 WP_001051594.1.56658 WP_001051594.1.5666 WP_001051594.1.56679 WP_001051594.1.56702 WP_001051594.1.56708 WP_001051594.1.56737 WP_001051594.1.5675 WP_001051594.1.56767 WP_001051594.1.5677 WP_001051594.1.56778 WP_001051594.1.56779 WP_001051594.1.56794 WP_001051594.1.56815 WP_001051594.1.56822 WP_001051594.1.56856 WP_001051594.1.5686 WP_001051594.1.56865 WP_001051594.1.56878 WP_001051594.1.569 WP_001051594.1.56903 WP_001051594.1.56931 WP_001051594.1.56966 WP_001051594.1.56975 WP_001051594.1.56986 WP_001051594.1.57015 WP_001051594.1.57047 WP_001051594.1.5705 WP_001051594.1.57073 WP_001051594.1.57075 WP_001051594.1.57080 WP_001051594.1.57081 WP_001051594.1.57097 WP_001051594.1.57109 WP_001051594.1.57115 WP_001051594.1.57141 WP_001051594.1.57170 WP_001051594.1.5718 WP_001051594.1.57190 WP_001051594.1.57214 WP_001051594.1.57265 WP_001051594.1.57271 WP_001051594.1.57291 WP_001051594.1.57309 WP_001051594.1.57330 WP_001051594.1.57338 WP_001051594.1.5735 WP_001051594.1.57385 WP_001051594.1.57427 WP_001051594.1.5743 WP_001051594.1.57445 WP_001051594.1.57481 WP_001051594.1.5749 WP_001051594.1.57577 WP_001051594.1.57593 WP_001051594.1.57594 WP_001051594.1.57612 WP_001051594.1.57635 WP_001051594.1.57650 WP_001051594.1.57665 WP_001051594.1.57670 WP_001051594.1.57682 WP_001051594.1.57692 WP_001051594.1.57693 WP_001051594.1.57701 WP_001051594.1.57718 WP_001051594.1.57727 WP_001051594.1.57730 WP_001051594.1.57734 WP_001051594.1.57745 WP_001051594.1.57754 WP_001051594.1.57783 WP_001051594.1.57808 WP_001051594.1.57819 WP_001051594.1.57837 WP_001051594.1.57840 WP_001051594.1.57844 WP_001051594.1.57861 WP_001051594.1.57878 WP_001051594.1.5791 WP_001051594.1.57928 WP_001051594.1.57943 WP_001051594.1.57952 WP_001051594.1.57962 WP_001051594.1.57974 WP_001051594.1.5799 WP_001051594.1.58006 WP_001051594.1.58016 WP_001051594.1.58035 WP_001051594.1.58049 WP_001051594.1.58051 WP_001051594.1.58074 WP_001051594.1.58116 WP_001051594.1.58122 WP_001051594.1.58127 WP_001051594.1.58139 WP_001051594.1.58148 WP_001051594.1.58158 WP_001051594.1.5816 WP_001051594.1.5817 WP_001051594.1.58185 WP_001051594.1.58198 WP_001051594.1.58241 WP_001051594.1.58246 WP_001051594.1.5827 WP_001051594.1.58277 WP_001051594.1.58317 WP_001051594.1.58325 WP_001051594.1.58350 WP_001051594.1.58352 WP_001051594.1.58353 WP_001051594.1.58364 WP_001051594.1.58366 WP_001051594.1.58373 WP_001051594.1.58392 WP_001051594.1.58395 WP_001051594.1.58421 WP_001051594.1.58430 WP_001051594.1.58435 WP_001051594.1.58481 WP_001051594.1.5849 WP_001051594.1.58508 WP_001051594.1.58512 WP_001051594.1.58521 WP_001051594.1.58530 WP_001051594.1.5857 WP_001051594.1.58571 WP_001051594.1.58584 WP_001051594.1.58588 WP_001051594.1.58592 WP_001051594.1.58598 WP_001051594.1.586 WP_001051594.1.58603 WP_001051594.1.58626 WP_001051594.1.58686 WP_001051594.1.58704 WP_001051594.1.58714 WP_001051594.1.58718 WP_001051594.1.58735 WP_001051594.1.58760 WP_001051594.1.58763 WP_001051594.1.58775 WP_001051594.1.5880 WP_001051594.1.58833 WP_001051594.1.58855 WP_001051594.1.58860 WP_001051594.1.58934 WP_001051594.1.58936 WP_001051594.1.58981 WP_001051594.1.58998 WP_001051594.1.5901 WP_001051594.1.59011 WP_001051594.1.59014 WP_001051594.1.59039 WP_001051594.1.59077 WP_001051594.1.59098 WP_001051594.1.59124 WP_001051594.1.59133 WP_001051594.1.59146 WP_001051594.1.59178 WP_001051594.1.5920 WP_001051594.1.5925 WP_001051594.1.59269 WP_001051594.1.59284 WP_001051594.1.59311 WP_001051594.1.59327 WP_001051594.1.59329 WP_001051594.1.59334 WP_001051594.1.59337 WP_001051594.1.59363 WP_001051594.1.59397 WP_001051594.1.59398 WP_001051594.1.5940 WP_001051594.1.59404 WP_001051594.1.59414 WP_001051594.1.59457 WP_001051594.1.59459 WP_001051594.1.59462 WP_001051594.1.59464 WP_001051594.1.59467 WP_001051594.1.59478 WP_001051594.1.59489 WP_001051594.1.59498 WP_001051594.1.59540 WP_001051594.1.59547 WP_001051594.1.59594 WP_001051594.1.59598 WP_001051594.1.59603 WP_001051594.1.59609 WP_001051594.1.59624 WP_001051594.1.59629 WP_001051594.1.59663 WP_001051594.1.59668 WP_001051594.1.59669 WP_001051594.1.59671 WP_001051594.1.59697 WP_001051594.1.5972 WP_001051594.1.59787 WP_001051594.1.59803 WP_001051594.1.5982 WP_001051594.1.59822 WP_001051594.1.59864 WP_001051594.1.59874 WP_001051594.1.59881 WP_001051594.1.59886 WP_001051594.1.59907 WP_001051594.1.59915 WP_001051594.1.59977 WP_001051594.1.60006 WP_001051594.1.60022 WP_001051594.1.6006 WP_001051594.1.60086 WP_001051594.1.6011 WP_001051594.1.60123 WP_001051594.1.60149 WP_001051594.1.60156 WP_001051594.1.60157 WP_001051594.1.60158 WP_001051594.1.6017 WP_001051594.1.60227 WP_001051594.1.60251 WP_001051594.1.60259 WP_001051594.1.60280 WP_001051594.1.60302 WP_001051594.1.60307 WP_001051594.1.60339 WP_001051594.1.60353 WP_001051594.1.60360 WP_001051594.1.60368 WP_001051594.1.60431 WP_001051594.1.60434 WP_001051594.1.60462 WP_001051594.1.60492 WP_001051594.1.60515 WP_001051594.1.60547 WP_001051594.1.60551 WP_001051594.1.60585 WP_001051594.1.60594 WP_001051594.1.60595 WP_001051594.1.60636 WP_001051594.1.60641 WP_001051594.1.60690 WP_001051594.1.60696 WP_001051594.1.60719 WP_001051594.1.60730 WP_001051594.1.60734 WP_001051594.1.60742 WP_001051594.1.60750 WP_001051594.1.60751 WP_001051594.1.60758 WP_001051594.1.60759 WP_001051594.1.60765 WP_001051594.1.60787 WP_001051594.1.60813 WP_001051594.1.60820 WP_001051594.1.60845 WP_001051594.1.6085 WP_001051594.1.60859 WP_001051594.1.60869 WP_001051594.1.60888 WP_001051594.1.60898 WP_001051594.1.60923 WP_001051594.1.60934 WP_001051594.1.60939 WP_001051594.1.60946 WP_001051594.1.60948 WP_001051594.1.60965 WP_001051594.1.60981 WP_001051594.1.60982 WP_001051594.1.60991 WP_001051594.1.61013 WP_001051594.1.61019 WP_001051594.1.61023 WP_001051594.1.61026 WP_001051594.1.61029 WP_001051594.1.61030 WP_001051594.1.61031 WP_001051594.1.61082 WP_001051594.1.61115 WP_001051594.1.61119 WP_001051594.1.61139 WP_001051594.1.61152 WP_001051594.1.61153 WP_001051594.1.6118 WP_001051594.1.61189 WP_001051594.1.6119 WP_001051594.1.61224 WP_001051594.1.6123 WP_001051594.1.61257 WP_001051594.1.61263 WP_001051594.1.61271 WP_001051594.1.61286 WP_001051594.1.61289 WP_001051594.1.61313 WP_001051594.1.61316 WP_001051594.1.61318 WP_001051594.1.61324 WP_001051594.1.61327 WP_001051594.1.61339 WP_001051594.1.61346 WP_001051594.1.61353 WP_001051594.1.6136 WP_001051594.1.61375 WP_001051594.1.61408 WP_001051594.1.61413 WP_001051594.1.61421 WP_001051594.1.61430 WP_001051594.1.61439 WP_001051594.1.61440 WP_001051594.1.6149 WP_001051594.1.61547 WP_001051594.1.61555 WP_001051594.1.61585 WP_001051594.1.61591 WP_001051594.1.61597 WP_001051594.1.61615 WP_001051594.1.61639 WP_001051594.1.61653 WP_001051594.1.6166 WP_001051594.1.6168 WP_001051594.1.61705 WP_001051594.1.61709 WP_001051594.1.61713 WP_001051594.1.61749 WP_001051594.1.61776 WP_001051594.1.61784 WP_001051594.1.61800 WP_001051594.1.61802 WP_001051594.1.61831 WP_001051594.1.61838 WP_001051594.1.61843 WP_001051594.1.61903 WP_001051594.1.61910 WP_001051594.1.61936 WP_001051594.1.61970 WP_001051594.1.61976 WP_001051594.1.61978 WP_001051594.1.62002 WP_001051594.1.6201 WP_001051594.1.62028 WP_001051594.1.62030 WP_001051594.1.62069 WP_001051594.1.62071 WP_001051594.1.62088 WP_001051594.1.62093 WP_001051594.1.62096 WP_001051594.1.62127 WP_001051594.1.62140 WP_001051594.1.62164 WP_001051594.1.62247 WP_001051594.1.62254 WP_001051594.1.62346 WP_001051594.1.62352 WP_001051594.1.62367 WP_001051594.1.62382 WP_001051594.1.62392 WP_001051594.1.62398 WP_001051594.1.62409 WP_001051594.1.62429 WP_001051594.1.62437 WP_001051594.1.62453 WP_001051594.1.62459 WP_001051594.1.62462 WP_001051594.1.62474 WP_001051594.1.62496 WP_001051594.1.6250 WP_001051594.1.62539 WP_001051594.1.62553 WP_001051594.1.62563 WP_001051594.1.62575 WP_001051594.1.62602 WP_001051594.1.62625 WP_001051594.1.62630 WP_001051594.1.62653 WP_001051594.1.6266 WP_001051594.1.62671 WP_001051594.1.62674 WP_001051594.1.6268 WP_001051594.1.62684 WP_001051594.1.62685 WP_001051594.1.62723 WP_001051594.1.62740 WP_001051594.1.62756 WP_001051594.1.62764 WP_001051594.1.62771 WP_001051594.1.62781 WP_001051594.1.62796 WP_001051594.1.62808 WP_001051594.1.62822 WP_001051594.1.62824 WP_001051594.1.62829 WP_001051594.1.62831 WP_001051594.1.62842 WP_001051594.1.62863 WP_001051594.1.62878 WP_001051594.1.62880 WP_001051594.1.62925 WP_001051594.1.62956 WP_001051594.1.62970 WP_001051594.1.63003 WP_001051594.1.63011 WP_001051594.1.63021 WP_001051594.1.63027 WP_001051594.1.63050 WP_001051594.1.63052 WP_001051594.1.63070 WP_001051594.1.63083 WP_001051594.1.631 WP_001051594.1.63132 WP_001051594.1.63139 WP_001051594.1.63140 WP_001051594.1.63195 WP_001051594.1.63220 WP_001051594.1.63233 WP_001051594.1.63244 WP_001051594.1.63266 WP_001051594.1.63273 WP_001051594.1.63279 WP_001051594.1.63288 WP_001051594.1.63289 WP_001051594.1.63296 WP_001051594.1.63304 WP_001051594.1.63307 WP_001051594.1.63313 WP_001051594.1.63319 WP_001051594.1.63324 WP_001051594.1.63333 WP_001051594.1.63335 WP_001051594.1.63337 WP_001051594.1.63341 WP_001051594.1.63383 WP_001051594.1.634 WP_001051594.1.63406 WP_001051594.1.63411 WP_001051594.1.63421 WP_001051594.1.63441 WP_001051594.1.63460 WP_001051594.1.63469 WP_001051594.1.63471 WP_001051594.1.63510 WP_001051594.1.63527 WP_001051594.1.63540 WP_001051594.1.63565 WP_001051594.1.63589 WP_001051594.1.63617 WP_001051594.1.63672 WP_001051594.1.63673 WP_001051594.1.63678 WP_001051594.1.63693 WP_001051594.1.63704 WP_001051594.1.63705 WP_001051594.1.63726 WP_001051594.1.63729 WP_001051594.1.63751 WP_001051594.1.63759 WP_001051594.1.63763 WP_001051594.1.63774 WP_001051594.1.6378 WP_001051594.1.63828 WP_001051594.1.63847 WP_001051594.1.6388 WP_001051594.1.63890 WP_001051594.1.63894 WP_001051594.1.63907 WP_001051594.1.63910 WP_001051594.1.64012 WP_001051594.1.6403 WP_001051594.1.64060 WP_001051594.1.6408 WP_001051594.1.64094 WP_001051594.1.64108 WP_001051594.1.64181 WP_001051594.1.64192 WP_001051594.1.64207 WP_001051594.1.64250 WP_001051594.1.64303 WP_001051594.1.64304 WP_001051594.1.64367 WP_001051594.1.64368 WP_001051594.1.6438 WP_001051594.1.64400 WP_001051594.1.64408 WP_001051594.1.64446 WP_001051594.1.64456 WP_001051594.1.64457 WP_001051594.1.645 WP_001051594.1.64525 WP_001051594.1.64537 WP_001051594.1.64565 WP_001051594.1.64583 WP_001051594.1.6459 WP_001051594.1.6462 WP_001051594.1.64630 WP_001051594.1.64631 WP_001051594.1.64643 WP_001051594.1.64665 WP_001051594.1.64677 WP_001051594.1.64686 WP_001051594.1.64720 WP_001051594.1.64765 WP_001051594.1.6479 WP_001051594.1.64811 WP_001051594.1.64845 WP_001051594.1.64858 WP_001051594.1.64860 WP_001051594.1.64879 WP_001051594.1.6488 WP_001051594.1.64893 WP_001051594.1.64897 WP_001051594.1.64911 WP_001051594.1.64928 WP_001051594.1.64935 WP_001051594.1.64951 WP_001051594.1.64956 WP_001051594.1.64961 WP_001051594.1.64996 WP_001051594.1.64998 WP_001051594.1.65025 WP_001051594.1.65033 WP_001051594.1.65038 WP_001051594.1.65044 WP_001051594.1.65076 WP_001051594.1.65132 WP_001051594.1.65158 WP_001051594.1.65164 WP_001051594.1.65180 WP_001051594.1.65193 WP_001051594.1.65217 WP_001051594.1.65233 WP_001051594.1.65243 WP_001051594.1.65264 WP_001051594.1.65274 WP_001051594.1.65317 WP_001051594.1.65358 WP_001051594.1.65367 WP_001051594.1.65387 WP_001051594.1.65406 WP_001051594.1.65407 WP_001051594.1.65419 WP_001051594.1.65423 WP_001051594.1.65432 WP_001051594.1.6544 WP_001051594.1.65443 WP_001051594.1.65448 WP_001051594.1.65451 WP_001051594.1.6547 WP_001051594.1.65504 WP_001051594.1.6551 WP_001051594.1.65520 WP_001051594.1.65544 WP_001051594.1.65562 WP_001051594.1.65585 WP_001051594.1.65616 WP_001051594.1.65629 WP_001051594.1.65643 WP_001051594.1.65656 WP_001051594.1.65675 WP_001051594.1.6568 WP_001051594.1.65689 WP_001051594.1.65693 WP_001051594.1.65700 WP_001051594.1.65703 WP_001051594.1.65704 WP_001051594.1.65705 WP_001051594.1.65713 WP_001051594.1.65734 WP_001051594.1.65769 WP_001051594.1.6578 WP_001051594.1.65809 WP_001051594.1.6585 WP_001051594.1.65856 WP_001051594.1.65892 WP_001051594.1.65922 WP_001051594.1.65928 WP_001051594.1.65931 WP_001051594.1.65935 WP_001051594.1.65947 WP_001051594.1.65948 WP_001051594.1.65965 WP_001051594.1.65990 WP_001051594.1.66009 WP_001051594.1.66014 WP_001051594.1.6603 WP_001051594.1.66054 WP_001051594.1.66069 WP_001051594.1.66073 WP_001051594.1.66081 WP_001051594.1.661 WP_001051594.1.66120 WP_001051594.1.66130 WP_001051594.1.66133 WP_001051594.1.66144 WP_001051594.1.66175 WP_001051594.1.66262 WP_001051594.1.66265 WP_001051594.1.66287 WP_001051594.1.66298 WP_001051594.1.66302 WP_001051594.1.6632 WP_001051594.1.66366 WP_001051594.1.66453 WP_001051594.1.66505 WP_001051594.1.66513 WP_001051594.1.66518 WP_001051594.1.66519 WP_001051594.1.66542 WP_001051594.1.66556 WP_001051594.1.66564 WP_001051594.1.66588 WP_001051594.1.66598 WP_001051594.1.66601 WP_001051594.1.66606 WP_001051594.1.66611 WP_001051594.1.66614 WP_001051594.1.6662 WP_001051594.1.66645 WP_001051594.1.66664 WP_001051594.1.66677 WP_001051594.1.66690 WP_001051594.1.66705 WP_001051594.1.66711 WP_001051594.1.66756 WP_001051594.1.66766 WP_001051594.1.66786 WP_001051594.1.66792 WP_001051594.1.66803 WP_001051594.1.66816 WP_001051594.1.66818 WP_001051594.1.6684 WP_001051594.1.66853 WP_001051594.1.66879 WP_001051594.1.6688 WP_001051594.1.66906 WP_001051594.1.66938 WP_001051594.1.66969 WP_001051594.1.6700 WP_001051594.1.67012 WP_001051594.1.67014 WP_001051594.1.67016 WP_001051594.1.67067 WP_001051594.1.67072 WP_001051594.1.67112 WP_001051594.1.67113 WP_001051594.1.67135 WP_001051594.1.67152 WP_001051594.1.67155 WP_001051594.1.67160 WP_001051594.1.67191 WP_001051594.1.6722 WP_001051594.1.67238 WP_001051594.1.67251 WP_001051594.1.67259 WP_001051594.1.6726 WP_001051594.1.67266 WP_001051594.1.67286 WP_001051594.1.67294 WP_001051594.1.67312 WP_001051594.1.67328 WP_001051594.1.67329 WP_001051594.1.67333 WP_001051594.1.67375 WP_001051594.1.67379 WP_001051594.1.6740 WP_001051594.1.67414 WP_001051594.1.67418 WP_001051594.1.67420 WP_001051594.1.67425 WP_001051594.1.67447 WP_001051594.1.67457 WP_001051594.1.67460 WP_001051594.1.67463 WP_001051594.1.67480 WP_001051594.1.67505 WP_001051594.1.67507 WP_001051594.1.67520 WP_001051594.1.67521 WP_001051594.1.67540 WP_001051594.1.67554 WP_001051594.1.67571 WP_001051594.1.67572 WP_001051594.1.67620 WP_001051594.1.67621 WP_001051594.1.67632 WP_001051594.1.67644 WP_001051594.1.67651 WP_001051594.1.67652 WP_001051594.1.67653 WP_001051594.1.67691 WP_001051594.1.67713 WP_001051594.1.67722 WP_001051594.1.67754 WP_001051594.1.67798 WP_001051594.1.67800 WP_001051594.1.67806 WP_001051594.1.67808 WP_001051594.1.67815 WP_001051594.1.67834 WP_001051594.1.6786 WP_001051594.1.67865 WP_001051594.1.67867 WP_001051594.1.67880 WP_001051594.1.67900 WP_001051594.1.67925 WP_001051594.1.67931 WP_001051594.1.67986 WP_001051594.1.67991 WP_001051594.1.68020 WP_001051594.1.68033 WP_001051594.1.68054 WP_001051594.1.68066 WP_001051594.1.68101 WP_001051594.1.6811 WP_001051594.1.68111 WP_001051594.1.68134 WP_001051594.1.68139 WP_001051594.1.68141 WP_001051594.1.68152 WP_001051594.1.68160 WP_001051594.1.68161 WP_001051594.1.68199 WP_001051594.1.68202 WP_001051594.1.68221 WP_001051594.1.68223 WP_001051594.1.6824 WP_001051594.1.68261 WP_001051594.1.68268 WP_001051594.1.68295 WP_001051594.1.68296 WP_001051594.1.68299 WP_001051594.1.6830 WP_001051594.1.68307 WP_001051594.1.6834 WP_001051594.1.68343 WP_001051594.1.68351 WP_001051594.1.68355 WP_001051594.1.68366 WP_001051594.1.68367 WP_001051594.1.6839 WP_001051594.1.68392 WP_001051594.1.68397 WP_001051594.1.68398 WP_001051594.1.68399 WP_001051594.1.68404 WP_001051594.1.68425 WP_001051594.1.68476 WP_001051594.1.68479 WP_001051594.1.68483 WP_001051594.1.68489 WP_001051594.1.68504 WP_001051594.1.68512 WP_001051594.1.68522 WP_001051594.1.68548 WP_001051594.1.68565 WP_001051594.1.686 WP_001051594.1.68636 WP_001051594.1.68650 WP_001051594.1.68681 WP_001051594.1.68683 WP_001051594.1.68699 WP_001051594.1.68703 WP_001051594.1.68728 WP_001051594.1.68737 WP_001051594.1.68741 WP_001051594.1.68743 WP_001051594.1.68747 WP_001051594.1.68773 WP_001051594.1.68775 WP_001051594.1.68813 WP_001051594.1.68831 WP_001051594.1.68854 WP_001051594.1.68864 WP_001051594.1.68875 WP_001051594.1.68883 WP_001051594.1.68931 WP_001051594.1.68943 WP_001051594.1.68944 WP_001051594.1.68998 WP_001051594.1.69012 WP_001051594.1.69045 WP_001051594.1.69071 WP_001051594.1.69078 WP_001051594.1.69087 WP_001051594.1.69089 WP_001051594.1.691 WP_001051594.1.69105 WP_001051594.1.69147 WP_001051594.1.6915 WP_001051594.1.69162 WP_001051594.1.6917 WP_001051594.1.69179 WP_001051594.1.69191 WP_001051594.1.69198 WP_001051594.1.69213 WP_001051594.1.69219 WP_001051594.1.69222 WP_001051594.1.69237 WP_001051594.1.69239 WP_001051594.1.69251 WP_001051594.1.69349 WP_001051594.1.69366 WP_001051594.1.69394 WP_001051594.1.69395 WP_001051594.1.69412 WP_001051594.1.69415 WP_001051594.1.69437 WP_001051594.1.69475 WP_001051594.1.69476 WP_001051594.1.69480 WP_001051594.1.69483 WP_001051594.1.69489 WP_001051594.1.69490 WP_001051594.1.695 WP_001051594.1.69520 WP_001051594.1.6953 WP_001051594.1.69546 WP_001051594.1.69552 WP_001051594.1.69563 WP_001051594.1.69598 WP_001051594.1.69622 WP_001051594.1.69639 WP_001051594.1.69679 WP_001051594.1.6968 WP_001051594.1.69683 WP_001051594.1.69724 WP_001051594.1.69734 WP_001051594.1.6980 WP_001051594.1.69820 WP_001051594.1.69823 WP_001051594.1.69830 WP_001051594.1.69877 WP_001051594.1.69878 WP_001051594.1.69882 WP_001051594.1.699 WP_001051594.1.69902 WP_001051594.1.69921 WP_001051594.1.69934 WP_001051594.1.69980 WP_001051594.1.69987 WP_001051594.1.69995 WP_001051594.1.70024 WP_001051594.1.70048 WP_001051594.1.70105 WP_001051594.1.7012 WP_001051594.1.70133 WP_001051594.1.70161 WP_001051594.1.70210 WP_001051594.1.70220 WP_001051594.1.70225 WP_001051594.1.70228 WP_001051594.1.7024 WP_001051594.1.70253 WP_001051594.1.70266 WP_001051594.1.70273 WP_001051594.1.70294 WP_001051594.1.703 WP_001051594.1.70311 WP_001051594.1.70313 WP_001051594.1.70334 WP_001051594.1.7034 WP_001051594.1.70344 WP_001051594.1.70349 WP_001051594.1.7043 WP_001051594.1.70448 WP_001051594.1.70451 WP_001051594.1.70457 WP_001051594.1.70459 WP_001051594.1.7046 WP_001051594.1.70462 WP_001051594.1.70487 WP_001051594.1.70495 WP_001051594.1.70527 WP_001051594.1.7053 WP_001051594.1.70541 WP_001051594.1.70546 WP_001051594.1.70554 WP_001051594.1.70558 WP_001051594.1.70564 WP_001051594.1.7061 WP_001051594.1.70635 WP_001051594.1.7064 WP_001051594.1.70641 WP_001051594.1.70664 WP_001051594.1.7067 WP_001051594.1.70672 WP_001051594.1.707 WP_001051594.1.70721 WP_001051594.1.7073 WP_001051594.1.70763 WP_001051594.1.70808 WP_001051594.1.70818 WP_001051594.1.70823 WP_001051594.1.70829 WP_001051594.1.70835 WP_001051594.1.70843 WP_001051594.1.70855 WP_001051594.1.70909 WP_001051594.1.70924 WP_001051594.1.70926 WP_001051594.1.70930 WP_001051594.1.70943 WP_001051594.1.70994 WP_001051594.1.710 WP_001051594.1.71016 WP_001051594.1.71027 WP_001051594.1.71043 WP_001051594.1.7105 WP_001051594.1.71058 WP_001051594.1.71059 WP_001051594.1.71073 WP_001051594.1.7109 WP_001051594.1.71130 WP_001051594.1.71143 WP_001051594.1.71182 WP_001051594.1.71196 WP_001051594.1.7120 WP_001051594.1.71208 WP_001051594.1.71231 WP_001051594.1.71236 WP_001051594.1.7125 WP_001051594.1.71257 WP_001051594.1.71266 WP_001051594.1.71267 WP_001051594.1.71280 WP_001051594.1.71295 WP_001051594.1.71298 WP_001051594.1.71301 WP_001051594.1.71313 WP_001051594.1.71325 WP_001051594.1.71345 WP_001051594.1.71359 WP_001051594.1.71404 WP_001051594.1.71416 WP_001051594.1.71419 WP_001051594.1.71428 WP_001051594.1.71438 WP_001051594.1.71463 WP_001051594.1.71466 WP_001051594.1.71467 WP_001051594.1.71475 WP_001051594.1.7150 WP_001051594.1.71519 WP_001051594.1.71529 WP_001051594.1.71541 WP_001051594.1.71543 WP_001051594.1.7158 WP_001051594.1.71590 WP_001051594.1.71596 WP_001051594.1.71602 WP_001051594.1.7161 WP_001051594.1.71662 WP_001051594.1.71676 WP_001051594.1.71715 WP_001051594.1.71735 WP_001051594.1.71737 WP_001051594.1.71739 WP_001051594.1.71741 WP_001051594.1.71771 WP_001051594.1.71780 WP_001051594.1.7179 WP_001051594.1.71800 WP_001051594.1.71836 WP_001051594.1.71861 WP_001051594.1.71863 WP_001051594.1.71877 WP_001051594.1.71892 WP_001051594.1.71899 WP_001051594.1.71910 WP_001051594.1.71925 WP_001051594.1.71978 WP_001051594.1.71981 WP_001051594.1.71989 WP_001051594.1.72002 WP_001051594.1.72018 WP_001051594.1.72026 WP_001051594.1.72031 WP_001051594.1.72067 WP_001051594.1.72085 WP_001051594.1.72148 WP_001051594.1.72169 WP_001051594.1.72176 WP_001051594.1.722 WP_001051594.1.72204 WP_001051594.1.72205 WP_001051594.1.72257 WP_001051594.1.72271 WP_001051594.1.72306 WP_001051594.1.72330 WP_001051594.1.72340 WP_001051594.1.72347 WP_001051594.1.7236 WP_001051594.1.72363 WP_001051594.1.72366 WP_001051594.1.72371 WP_001051594.1.72424 WP_001051594.1.72453 WP_001051594.1.72465 WP_001051594.1.72478 WP_001051594.1.72489 WP_001051594.1.72497 WP_001051594.1.72529 WP_001051594.1.72547 WP_001051594.1.7258 WP_001051594.1.7260 WP_001051594.1.72626 WP_001051594.1.72649 WP_001051594.1.72654 WP_001051594.1.72666 WP_001051594.1.72708 WP_001051594.1.72719 WP_001051594.1.72750 WP_001051594.1.72753 WP_001051594.1.72760 WP_001051594.1.72762 WP_001051594.1.72787 WP_001051594.1.72816 WP_001051594.1.72832 WP_001051594.1.72834 WP_001051594.1.72835 WP_001051594.1.72874 WP_001051594.1.72881 WP_001051594.1.72903 WP_001051594.1.72904 WP_001051594.1.72930 WP_001051594.1.72935 WP_001051594.1.7294 WP_001051594.1.72945 WP_001051594.1.72961 WP_001051594.1.72991 WP_001051594.1.73002 WP_001051594.1.73017 WP_001051594.1.73019 WP_001051594.1.73021 WP_001051594.1.73022 WP_001051594.1.73037 WP_001051594.1.73087 WP_001051594.1.73122 WP_001051594.1.73132 WP_001051594.1.73140 WP_001051594.1.73190 WP_001051594.1.73195 WP_001051594.1.73201 WP_001051594.1.73211 WP_001051594.1.73240 WP_001051594.1.73241 WP_001051594.1.73246 WP_001051594.1.73264 WP_001051594.1.73265 WP_001051594.1.73286 WP_001051594.1.73386 WP_001051594.1.73401 WP_001051594.1.73420 WP_001051594.1.73444 WP_001051594.1.73450 WP_001051594.1.73456 WP_001051594.1.73464 WP_001051594.1.73489 WP_001051594.1.73501 WP_001051594.1.73513 WP_001051594.1.73536 WP_001051594.1.73539 WP_001051594.1.73547 WP_001051594.1.73571 WP_001051594.1.73591 WP_001051594.1.736 WP_001051594.1.7360 WP_001051594.1.73610 WP_001051594.1.73639 WP_001051594.1.7365 WP_001051594.1.73674 WP_001051594.1.73685 WP_001051594.1.73687 WP_001051594.1.73694 WP_001051594.1.73735 WP_001051594.1.73740 WP_001051594.1.73759 WP_001051594.1.73786 WP_001051594.1.73789 WP_001051594.1.7380 WP_001051594.1.73834 WP_001051594.1.73837 WP_001051594.1.73858 WP_001051594.1.73868 WP_001051594.1.73885 WP_001051594.1.73900 WP_001051594.1.73910 WP_001051594.1.73920 WP_001051594.1.73921 WP_001051594.1.73940 WP_001051594.1.73949 WP_001051594.1.73961 WP_001051594.1.73969 WP_001051594.1.73971 WP_001051594.1.73976 WP_001051594.1.73983 WP_001051594.1.74004 WP_001051594.1.74006 WP_001051594.1.7401 WP_001051594.1.74010 WP_001051594.1.74025 WP_001051594.1.74027 WP_001051594.1.7406 WP_001051594.1.74073 WP_001051594.1.74081 WP_001051594.1.74085 WP_001051594.1.74155 WP_001051594.1.74157 WP_001051594.1.74161 WP_001051594.1.74172 WP_001051594.1.74173 WP_001051594.1.74183 WP_001051594.1.74216 WP_001051594.1.74234 WP_001051594.1.74237 WP_001051594.1.74242 WP_001051594.1.74257 WP_001051594.1.7427 WP_001051594.1.74284 WP_001051594.1.74295 WP_001051594.1.74327 WP_001051594.1.7434 WP_001051594.1.74353 WP_001051594.1.74356 WP_001051594.1.74380 WP_001051594.1.74429 WP_001051594.1.74456 WP_001051594.1.74457 WP_001051594.1.74468 WP_001051594.1.7457 WP_001051594.1.74576 WP_001051594.1.74587 WP_001051594.1.74610 WP_001051594.1.74638 WP_001051594.1.74676 WP_001051594.1.74681 WP_001051594.1.74696 WP_001051594.1.74704 WP_001051594.1.74731 WP_001051594.1.74747 WP_001051594.1.74758 WP_001051594.1.74770 WP_001051594.1.74785 WP_001051594.1.74797 WP_001051594.1.74802 WP_001051594.1.7482 WP_001051594.1.74840 WP_001051594.1.74866 WP_001051594.1.74874 WP_001051594.1.74890 WP_001051594.1.74911 WP_001051594.1.74922 WP_001051594.1.74924 WP_001051594.1.74961 WP_001051594.1.74994 WP_001051594.1.74999 WP_001051594.1.75038 WP_001051594.1.75044 WP_001051594.1.75052 WP_001051594.1.75070 WP_001051594.1.75093 WP_001051594.1.75111 WP_001051594.1.75127 WP_001051594.1.75131 WP_001051594.1.75132 WP_001051594.1.75141 WP_001051594.1.75186 WP_001051594.1.75227 WP_001051594.1.75252 WP_001051594.1.75294 WP_001051594.1.75298 WP_001051594.1.75320 WP_001051594.1.75323 WP_001051594.1.75327 WP_001051594.1.75349 WP_001051594.1.75351 WP_001051594.1.75356 WP_001051594.1.75365 WP_001051594.1.75399 WP_001051594.1.75409 WP_001051594.1.7542 WP_001051594.1.75438 WP_001051594.1.75440 WP_001051594.1.75521 WP_001051594.1.75527 WP_001051594.1.75538 WP_001051594.1.75551 WP_001051594.1.75566 WP_001051594.1.75571 WP_001051594.1.75590 WP_001051594.1.7561 WP_001051594.1.75647 WP_001051594.1.75649 WP_001051594.1.75652 WP_001051594.1.75685 WP_001051594.1.75692 WP_001051594.1.75704 WP_001051594.1.75728 WP_001051594.1.75743 WP_001051594.1.75769 WP_001051594.1.75775 WP_001051594.1.75800 WP_001051594.1.75805 WP_001051594.1.75809 WP_001051594.1.75830 WP_001051594.1.75840 WP_001051594.1.75862 WP_001051594.1.75881 WP_001051594.1.75885 WP_001051594.1.75910 WP_001051594.1.75929 WP_001051594.1.75944 WP_001051594.1.75952 WP_001051594.1.7596 WP_001051594.1.76010 WP_001051594.1.76013 WP_001051594.1.76015 WP_001051594.1.7602 WP_001051594.1.76047 WP_001051594.1.76049 WP_001051594.1.76050 WP_001051594.1.76053 WP_001051594.1.76095 WP_001051594.1.76104 WP_001051594.1.76111 WP_001051594.1.76114 WP_001051594.1.76121 WP_001051594.1.76123 WP_001051594.1.76153 WP_001051594.1.76179 WP_001051594.1.76230 WP_001051594.1.76234 WP_001051594.1.7624 WP_001051594.1.7625 WP_001051594.1.76258 WP_001051594.1.76261 WP_001051594.1.7627 WP_001051594.1.76282 WP_001051594.1.76313 WP_001051594.1.76332 WP_001051594.1.76337 WP_001051594.1.76351 WP_001051594.1.76419 WP_001051594.1.76421 WP_001051594.1.76424 WP_001051594.1.76426 WP_001051594.1.76431 WP_001051594.1.76463 WP_001051594.1.76497 WP_001051594.1.765 WP_001051594.1.76606 WP_001051594.1.76624 WP_001051594.1.76648 WP_001051594.1.76659 WP_001051594.1.76674 WP_001051594.1.76686 WP_001051594.1.76689 WP_001051594.1.76690 WP_001051594.1.76693 WP_001051594.1.76711 WP_001051594.1.76718 WP_001051594.1.7675 WP_001051594.1.76790 WP_001051594.1.76792 WP_001051594.1.76798 WP_001051594.1.768 WP_001051594.1.76803 WP_001051594.1.76816 WP_001051594.1.76820 WP_001051594.1.76829 WP_001051594.1.76839 WP_001051594.1.76845 WP_001051594.1.76869 WP_001051594.1.76895 WP_001051594.1.76921 WP_001051594.1.7694 WP_001051594.1.76944 WP_001051594.1.76952 WP_001051594.1.76998 WP_001051594.1.77031 WP_001051594.1.77041 WP_001051594.1.77043 WP_001051594.1.77060 WP_001051594.1.77062 WP_001051594.1.77072 WP_001051594.1.77112 WP_001051594.1.77137 WP_001051594.1.77144 WP_001051594.1.77145 WP_001051594.1.77158 WP_001051594.1.77187 WP_001051594.1.77190 WP_001051594.1.77203 WP_001051594.1.77229 WP_001051594.1.77297 WP_001051594.1.77298 WP_001051594.1.77305 WP_001051594.1.77331 WP_001051594.1.77346 WP_001051594.1.77359 WP_001051594.1.77388 WP_001051594.1.77460 WP_001051594.1.77485 WP_001051594.1.77489 WP_001051594.1.77497 WP_001051594.1.77498 WP_001051594.1.7752 WP_001051594.1.77520 WP_001051594.1.77527 WP_001051594.1.77532 WP_001051594.1.77533 WP_001051594.1.77572 WP_001051594.1.77583 WP_001051594.1.77603 WP_001051594.1.77606 WP_001051594.1.77650 WP_001051594.1.77733 WP_001051594.1.77735 WP_001051594.1.77738 WP_001051594.1.7774 WP_001051594.1.77743 WP_001051594.1.77791 WP_001051594.1.77818 WP_001051594.1.77848 WP_001051594.1.7785 WP_001051594.1.77858 WP_001051594.1.7786 WP_001051594.1.77860 WP_001051594.1.7787 WP_001051594.1.77882 WP_001051594.1.77883 WP_001051594.1.77893 WP_001051594.1.77915 WP_001051594.1.77922 WP_001051594.1.77930 WP_001051594.1.77952 WP_001051594.1.77957 WP_001051594.1.77986 WP_001051594.1.78038 WP_001051594.1.78054 WP_001051594.1.78082 WP_001051594.1.78091 WP_001051594.1.78093 WP_001051594.1.78095 WP_001051594.1.7810 WP_001051594.1.78164 WP_001051594.1.78173 WP_001051594.1.78179 WP_001051594.1.78189 WP_001051594.1.78194 WP_001051594.1.78207 WP_001051594.1.78208 WP_001051594.1.78252 WP_001051594.1.78254 WP_001051594.1.78257 WP_001051594.1.7827 WP_001051594.1.78304 WP_001051594.1.78311 WP_001051594.1.78324 WP_001051594.1.7833 WP_001051594.1.78330 WP_001051594.1.78332 WP_001051594.1.78335 WP_001051594.1.78365 WP_001051594.1.78371 WP_001051594.1.78392 WP_001051594.1.78404 WP_001051594.1.78434 WP_001051594.1.78436 WP_001051594.1.78470 WP_001051594.1.78489 WP_001051594.1.78494 WP_001051594.1.7850 WP_001051594.1.7853 WP_001051594.1.78558 WP_001051594.1.7857 WP_001051594.1.78573 WP_001051594.1.78585 WP_001051594.1.78592 WP_001051594.1.78604 WP_001051594.1.78638 WP_001051594.1.78653 WP_001051594.1.78662 WP_001051594.1.78667 WP_001051594.1.7868 WP_001051594.1.78685 WP_001051594.1.78728 WP_001051594.1.78736 WP_001051594.1.78758 WP_001051594.1.78763 WP_001051594.1.78785 WP_001051594.1.78803 WP_001051594.1.78816 WP_001051594.1.78819 WP_001051594.1.78841 WP_001051594.1.78897 WP_001051594.1.78920 WP_001051594.1.78937 WP_001051594.1.78978 WP_001051594.1.78983 WP_001051594.1.78985 WP_001051594.1.78991 WP_001051594.1.78995 WP_001051594.1.7900 WP_001051594.1.79006 WP_001051594.1.79038 WP_001051594.1.7905 WP_001051594.1.79051 WP_001051594.1.79059 WP_001051594.1.79085 WP_001051594.1.79110 WP_001051594.1.79131 WP_001051594.1.7914 WP_001051594.1.79143 WP_001051594.1.79156 WP_001051594.1.79170 WP_001051594.1.79178 WP_001051594.1.79192 WP_001051594.1.79197 WP_001051594.1.79208 WP_001051594.1.79223 WP_001051594.1.79227 WP_001051594.1.79275 WP_001051594.1.79285 WP_001051594.1.7931 WP_001051594.1.79310 WP_001051594.1.79314 WP_001051594.1.79322 WP_001051594.1.79332 WP_001051594.1.79367 WP_001051594.1.79374 WP_001051594.1.79378 WP_001051594.1.79408 WP_001051594.1.79436 WP_001051594.1.79452 WP_001051594.1.79461 WP_001051594.1.79476 WP_001051594.1.79487 WP_001051594.1.79539 WP_001051594.1.79552 WP_001051594.1.79556 WP_001051594.1.79581 WP_001051594.1.79626 WP_001051594.1.79627 WP_001051594.1.79638 WP_001051594.1.79662 WP_001051594.1.79664 WP_001051594.1.79672 WP_001051594.1.79676 WP_001051594.1.79677 WP_001051594.1.79706 WP_001051594.1.79731 WP_001051594.1.79737 WP_001051594.1.79763 WP_001051594.1.7981 WP_001051594.1.79815 WP_001051594.1.79822 WP_001051594.1.79831 WP_001051594.1.79834 WP_001051594.1.79837 WP_001051594.1.79854 WP_001051594.1.7989 WP_001051594.1.79896 WP_001051594.1.79904 WP_001051594.1.79911 WP_001051594.1.7992 WP_001051594.1.79941 WP_001051594.1.79949 WP_001051594.1.79961 WP_001051594.1.79971 WP_001051594.1.79991 WP_001051594.1.80000 WP_001051594.1.80009 WP_001051594.1.80013 WP_001051594.1.80029 WP_001051594.1.80032 WP_001051594.1.80042 WP_001051594.1.80079 WP_001051594.1.80086 WP_001051594.1.80109 WP_001051594.1.80119 WP_001051594.1.80120 WP_001051594.1.80122 WP_001051594.1.80127 WP_001051594.1.80146 WP_001051594.1.80152 WP_001051594.1.80178 WP_001051594.1.80184 WP_001051594.1.80203 WP_001051594.1.80210 WP_001051594.1.80244 WP_001051594.1.80274 WP_001051594.1.80286 WP_001051594.1.80287 WP_001051594.1.80290 WP_001051594.1.80297 WP_001051594.1.8030 WP_001051594.1.8031 WP_001051594.1.80316 WP_001051594.1.8035 WP_001051594.1.80358 WP_001051594.1.80361 WP_001051594.1.80378 WP_001051594.1.80389 WP_001051594.1.8040 WP_001051594.1.80407 WP_001051594.1.8043 WP_001051594.1.80434 WP_001051594.1.8045 WP_001051594.1.80472 WP_001051594.1.80521 WP_001051594.1.80530 WP_001051594.1.80582 WP_001051594.1.80647 WP_001051594.1.8065 WP_001051594.1.80653 WP_001051594.1.80687 WP_001051594.1.80717 WP_001051594.1.80745 WP_001051594.1.80761 WP_001051594.1.80762 WP_001051594.1.80763 WP_001051594.1.80781 WP_001051594.1.80786 WP_001051594.1.80833 WP_001051594.1.8084 WP_001051594.1.80845 WP_001051594.1.80872 WP_001051594.1.80899 WP_001051594.1.80962 WP_001051594.1.81022 WP_001051594.1.81049 WP_001051594.1.81052 WP_001051594.1.81064 WP_001051594.1.81085 WP_001051594.1.81097 WP_001051594.1.81114 WP_001051594.1.81132 WP_001051594.1.81151 WP_001051594.1.81157 WP_001051594.1.81171 WP_001051594.1.81172 WP_001051594.1.81176 WP_001051594.1.81184 WP_001051594.1.81214 WP_001051594.1.81224 WP_001051594.1.81228 WP_001051594.1.81234 WP_001051594.1.81243 WP_001051594.1.8125 WP_001051594.1.81252 WP_001051594.1.81288 WP_001051594.1.81290 WP_001051594.1.81344 WP_001051594.1.8135 WP_001051594.1.81379 WP_001051594.1.81385 WP_001051594.1.81387 WP_001051594.1.81389 WP_001051594.1.8142 WP_001051594.1.8144 WP_001051594.1.81464 WP_001051594.1.81467 WP_001051594.1.81508 WP_001051594.1.81532 WP_001051594.1.81574 WP_001051594.1.81599 WP_001051594.1.8160 WP_001051594.1.81604 WP_001051594.1.81610 WP_001051594.1.81619 WP_001051594.1.81645 WP_001051594.1.81740 WP_001051594.1.81758 WP_001051594.1.81767 WP_001051594.1.81789 WP_001051594.1.8180 WP_001051594.1.81800 WP_001051594.1.81810 WP_001051594.1.81812 WP_001051594.1.81831 WP_001051594.1.81837 WP_001051594.1.81838 WP_001051594.1.8185 WP_001051594.1.81861 WP_001051594.1.81870 WP_001051594.1.81897 WP_001051594.1.81903 WP_001051594.1.81905 WP_001051594.1.81906 WP_001051594.1.81919 WP_001051594.1.81944 WP_001051594.1.81955 WP_001051594.1.81969 WP_001051594.1.81982 WP_001051594.1.81990 WP_001051594.1.81999 WP_001051594.1.82009 WP_001051594.1.82017 WP_001051594.1.82053 WP_001051594.1.8206 WP_001051594.1.82103 WP_001051594.1.8212 WP_001051594.1.82121 WP_001051594.1.8213 WP_001051594.1.82174 WP_001051594.1.82184 WP_001051594.1.82219 WP_001051594.1.82234 WP_001051594.1.82247 WP_001051594.1.82253 WP_001051594.1.82259 WP_001051594.1.82278 WP_001051594.1.82281 WP_001051594.1.82301 WP_001051594.1.82315 WP_001051594.1.82340 WP_001051594.1.82349 WP_001051594.1.82354 WP_001051594.1.82358 WP_001051594.1.82368 WP_001051594.1.82406 WP_001051594.1.82447 WP_001051594.1.82455 WP_001051594.1.82458 WP_001051594.1.8246 WP_001051594.1.82467 WP_001051594.1.82468 WP_001051594.1.82525 WP_001051594.1.82548 WP_001051594.1.82558 WP_001051594.1.8261 WP_001051594.1.82612 WP_001051594.1.8265 WP_001051594.1.8266 WP_001051594.1.82664 WP_001051594.1.82678 WP_001051594.1.82709 WP_001051594.1.82724 WP_001051594.1.82768 WP_001051594.1.82796 WP_001051594.1.8280 WP_001051594.1.82802 WP_001051594.1.82824 WP_001051594.1.82829 WP_001051594.1.82855 WP_001051594.1.82862 WP_001051594.1.8288 WP_001051594.1.8289 WP_001051594.1.82930 WP_001051594.1.82941 WP_001051594.1.82976 WP_001051594.1.82980 WP_001051594.1.8302 WP_001051594.1.83021 WP_001051594.1.83046 WP_001051594.1.83054 WP_001051594.1.83078 WP_001051594.1.83086 WP_001051594.1.83103 WP_001051594.1.83152 WP_001051594.1.83153 WP_001051594.1.8318 WP_001051594.1.83185 WP_001051594.1.8319 WP_001051594.1.83193 WP_001051594.1.83203 WP_001051594.1.83234 WP_001051594.1.83249 WP_001051594.1.83250 WP_001051594.1.8328 WP_001051594.1.83291 WP_001051594.1.83316 WP_001051594.1.83352 WP_001051594.1.83359 WP_001051594.1.83372 WP_001051594.1.83405 WP_001051594.1.83417 WP_001051594.1.83418 WP_001051594.1.8346 WP_001051594.1.83467 WP_001051594.1.83472 WP_001051594.1.83476 WP_001051594.1.83479 WP_001051594.1.83484 WP_001051594.1.83517 WP_001051594.1.83520 WP_001051594.1.83553 WP_001051594.1.83593 WP_001051594.1.83597 WP_001051594.1.83624 WP_001051594.1.83646 WP_001051594.1.83652 WP_001051594.1.83653 WP_001051594.1.8366 WP_001051594.1.83674 WP_001051594.1.83676 WP_001051594.1.83720 WP_001051594.1.83728 WP_001051594.1.83750 WP_001051594.1.83756 WP_001051594.1.83758 WP_001051594.1.83763 WP_001051594.1.83769 WP_001051594.1.83770 WP_001051594.1.83775 WP_001051594.1.83788 WP_001051594.1.83792 WP_001051594.1.83797 WP_001051594.1.83804 WP_001051594.1.83816 WP_001051594.1.83825 WP_001051594.1.8383 WP_001051594.1.83844 WP_001051594.1.8385 WP_001051594.1.83864 WP_001051594.1.83865 WP_001051594.1.83868 WP_001051594.1.83881 WP_001051594.1.83886 WP_001051594.1.83905 WP_001051594.1.83912 WP_001051594.1.83919 WP_001051594.1.83928 WP_001051594.1.83955 WP_001051594.1.83984 WP_001051594.1.83989 WP_001051594.1.84025 WP_001051594.1.84049 WP_001051594.1.84054 WP_001051594.1.84064 WP_001051594.1.84118 WP_001051594.1.84129 WP_001051594.1.84144 WP_001051594.1.84161 WP_001051594.1.84163 WP_001051594.1.84188 WP_001051594.1.84194 WP_001051594.1.84275 WP_001051594.1.84293 WP_001051594.1.8432 WP_001051594.1.84342 WP_001051594.1.84415 WP_001051594.1.84418 WP_001051594.1.84442 WP_001051594.1.84445 WP_001051594.1.84451 WP_001051594.1.84508 WP_001051594.1.84509 WP_001051594.1.84563 WP_001051594.1.84578 WP_001051594.1.84590 WP_001051594.1.84596 WP_001051594.1.84608 WP_001051594.1.8462 WP_001051594.1.84625 WP_001051594.1.84638 WP_001051594.1.84648 WP_001051594.1.84651 WP_001051594.1.84673 WP_001051594.1.84679 WP_001051594.1.8468 WP_001051594.1.84682 WP_001051594.1.84696 WP_001051594.1.84714 WP_001051594.1.84736 WP_001051594.1.8475 WP_001051594.1.84752 WP_001051594.1.84757 WP_001051594.1.84761 WP_001051594.1.84815 WP_001051594.1.84826 WP_001051594.1.84847 WP_001051594.1.84854 WP_001051594.1.84889 WP_001051594.1.84903 WP_001051594.1.84907 WP_001051594.1.84922 WP_001051594.1.84924 WP_001051594.1.8493 WP_001051594.1.84943 WP_001051594.1.84951 WP_001051594.1.8496 WP_001051594.1.84975 WP_001051594.1.84978 WP_001051594.1.85017 WP_001051594.1.85022 WP_001051594.1.85026 WP_001051594.1.85045 WP_001051594.1.85047 WP_001051594.1.85056 WP_001051594.1.85070 WP_001051594.1.85081 WP_001051594.1.85099 WP_001051594.1.85118 WP_001051594.1.85133 WP_001051594.1.85135 WP_001051594.1.85144 WP_001051594.1.85151 WP_001051594.1.85198 WP_001051594.1.85213 WP_001051594.1.85226 WP_001051594.1.85229 WP_001051594.1.85231 WP_001051594.1.85235 WP_001051594.1.85238 WP_001051594.1.85265 WP_001051594.1.85289 WP_001051594.1.85302 WP_001051594.1.85331 WP_001051594.1.85351 WP_001051594.1.85375 WP_001051594.1.85376 WP_001051594.1.85383 WP_001051594.1.85391 WP_001051594.1.85395 WP_001051594.1.85401 WP_001051594.1.85404 WP_001051594.1.85409 WP_001051594.1.85425 WP_001051594.1.85441 WP_001051594.1.85445 WP_001051594.1.85462 WP_001051594.1.85471 WP_001051594.1.85474 WP_001051594.1.85485 WP_001051594.1.85492 WP_001051594.1.85506 WP_001051594.1.85515 WP_001051594.1.85519 WP_001051594.1.85547 WP_001051594.1.85549 WP_001051594.1.85555 WP_001051594.1.85562 WP_001051594.1.85585 WP_001051594.1.85586 WP_001051594.1.85596 WP_001051594.1.85611 WP_001051594.1.85634 WP_001051594.1.85649 WP_001051594.1.85730 WP_001051594.1.85732 WP_001051594.1.85758 WP_001051594.1.85795 WP_001051594.1.85796 WP_001051594.1.85816 WP_001051594.1.85834 WP_001051594.1.85858 WP_001051594.1.85906 WP_001051594.1.85924 WP_001051594.1.85927 WP_001051594.1.85950 WP_001051594.1.85971 WP_001051594.1.85980 WP_001051594.1.85989 WP_001051594.1.85993 WP_001051594.1.86018 WP_001051594.1.86036 WP_001051594.1.86042 WP_001051594.1.86072 WP_001051594.1.86086 WP_001051594.1.86123 WP_001051594.1.86136 WP_001051594.1.86144 WP_001051594.1.86153 WP_001051594.1.86154 WP_001051594.1.86158 WP_001051594.1.86188 WP_001051594.1.862 WP_001051594.1.86207 WP_001051594.1.86209 WP_001051594.1.86248 WP_001051594.1.8627 WP_001051594.1.86270 WP_001051594.1.86281 WP_001051594.1.86304 WP_001051594.1.86315 WP_001051594.1.86331 WP_001051594.1.86344 WP_001051594.1.8636 WP_001051594.1.86363 WP_001051594.1.86367 WP_001051594.1.86378 WP_001051594.1.86390 WP_001051594.1.8641 WP_001051594.1.8643 WP_001051594.1.86439 WP_001051594.1.86455 WP_001051594.1.86473 WP_001051594.1.86482 WP_001051594.1.86523 WP_001051594.1.86531 WP_001051594.1.86542 WP_001051594.1.86628 WP_001051594.1.8663 WP_001051594.1.86664 WP_001051594.1.86704 WP_001051594.1.86706 WP_001051594.1.86745 WP_001051594.1.86779 WP_001051594.1.86792 WP_001051594.1.86793 WP_001051594.1.86795 WP_001051594.1.8681 WP_001051594.1.86838 WP_001051594.1.86881 WP_001051594.1.8690 WP_001051594.1.86911 WP_001051594.1.86916 WP_001051594.1.86940 WP_001051594.1.86961 WP_001051594.1.86968 WP_001051594.1.86977 WP_001051594.1.86999 WP_001051594.1.87021 WP_001051594.1.87042 WP_001051594.1.87057 WP_001051594.1.87072 WP_001051594.1.87088 WP_001051594.1.87090 WP_001051594.1.87097 WP_001051594.1.87100 WP_001051594.1.87119 WP_001051594.1.8712 WP_001051594.1.87122 WP_001051594.1.87133 WP_001051594.1.87137 WP_001051594.1.87141 WP_001051594.1.87168 WP_001051594.1.87175 WP_001051594.1.87190 WP_001051594.1.87194 WP_001051594.1.8720 WP_001051594.1.87204 WP_001051594.1.87221 WP_001051594.1.87236 WP_001051594.1.87260 WP_001051594.1.87261 WP_001051594.1.87285 WP_001051594.1.87290 WP_001051594.1.87296 WP_001051594.1.8731 WP_001051594.1.87363 WP_001051594.1.87372 WP_001051594.1.87388 WP_001051594.1.87396 WP_001051594.1.87457 WP_001051594.1.87461 WP_001051594.1.87466 WP_001051594.1.87486 WP_001051594.1.875 WP_001051594.1.87508 WP_001051594.1.87511 WP_001051594.1.87515 WP_001051594.1.8753 WP_001051594.1.87534 WP_001051594.1.87541 WP_001051594.1.87543 WP_001051594.1.87593 WP_001051594.1.87595 WP_001051594.1.87636 WP_001051594.1.8764 WP_001051594.1.8770 WP_001051594.1.87710 WP_001051594.1.87718 WP_001051594.1.87734 WP_001051594.1.87745 WP_001051594.1.87748 WP_001051594.1.87764 WP_001051594.1.87782 WP_001051594.1.8779 WP_001051594.1.87808 WP_001051594.1.87828 WP_001051594.1.87838 WP_001051594.1.87841 WP_001051594.1.87854 WP_001051594.1.87865 WP_001051594.1.87879 WP_001051594.1.8791 WP_001051594.1.87912 WP_001051594.1.87937 WP_001051594.1.87963 WP_001051594.1.87964 WP_001051594.1.87967 WP_001051594.1.87972 WP_001051594.1.87995 WP_001051594.1.88013 WP_001051594.1.88032 WP_001051594.1.88061 WP_001051594.1.88114 WP_001051594.1.88150 WP_001051594.1.88169 WP_001051594.1.88212 WP_001051594.1.88270 WP_001051594.1.88309 WP_001051594.1.88311 WP_001051594.1.88317 WP_001051594.1.88319 WP_001051594.1.88339 WP_001051594.1.88351 WP_001051594.1.88367 WP_001051594.1.88371 WP_001051594.1.88373 WP_001051594.1.88375 WP_001051594.1.88380 WP_001051594.1.88418 WP_001051594.1.88430 WP_001051594.1.88440 WP_001051594.1.88445 WP_001051594.1.88449 WP_001051594.1.8847 WP_001051594.1.88480 WP_001051594.1.88498 WP_001051594.1.88504 WP_001051594.1.88518 WP_001051594.1.88555 WP_001051594.1.88558 WP_001051594.1.88563 WP_001051594.1.8857 WP_001051594.1.88572 WP_001051594.1.88580 WP_001051594.1.88585 WP_001051594.1.8859 WP_001051594.1.88599 WP_001051594.1.88600 WP_001051594.1.88614 WP_001051594.1.88623 WP_001051594.1.88636 WP_001051594.1.88638 WP_001051594.1.88642 WP_001051594.1.88671 WP_001051594.1.88696 WP_001051594.1.8872 WP_001051594.1.88739 WP_001051594.1.8877 WP_001051594.1.88771 WP_001051594.1.88781 WP_001051594.1.88843 WP_001051594.1.88856 WP_001051594.1.88859 WP_001051594.1.8886 WP_001051594.1.88878 WP_001051594.1.8888 WP_001051594.1.88881 WP_001051594.1.88897 WP_001051594.1.88922 WP_001051594.1.88934 WP_001051594.1.88954 WP_001051594.1.88960 WP_001051594.1.88962 WP_001051594.1.8899 WP_001051594.1.8900 WP_001051594.1.89012 WP_001051594.1.89024 WP_001051594.1.89036 WP_001051594.1.89086 WP_001051594.1.89125 WP_001051594.1.8913 WP_001051594.1.89133 WP_001051594.1.89139 WP_001051594.1.89164 WP_001051594.1.8918 WP_001051594.1.89181 WP_001051594.1.89184 WP_001051594.1.89194 WP_001051594.1.89195 WP_001051594.1.89204 WP_001051594.1.8924 WP_001051594.1.89258 WP_001051594.1.89262 WP_001051594.1.89284 WP_001051594.1.89290 WP_001051594.1.89348 WP_001051594.1.89350 WP_001051594.1.89372 WP_001051594.1.89390 WP_001051594.1.89404 WP_001051594.1.89433 WP_001051594.1.89476 WP_001051594.1.8950 WP_001051594.1.89516 WP_001051594.1.89537 WP_001051594.1.89544 WP_001051594.1.89545 WP_001051594.1.89556 WP_001051594.1.89557 WP_001051594.1.89559 WP_001051594.1.89655 WP_001051594.1.89672 WP_001051594.1.89678 WP_001051594.1.89686 WP_001051594.1.897 WP_001051594.1.89726 WP_001051594.1.89754 WP_001051594.1.89779 WP_001051594.1.89794 WP_001051594.1.89799 WP_001051594.1.898 WP_001051594.1.89857 WP_001051594.1.8986 WP_001051594.1.89863 WP_001051594.1.89883 WP_001051594.1.89908 WP_001051594.1.89935 WP_001051594.1.89949 WP_001051594.1.89950 WP_001051594.1.89960 WP_001051594.1.90005 WP_001051594.1.90018 WP_001051594.1.90038 WP_001051594.1.90046 WP_001051594.1.90055 WP_001051594.1.90069 WP_001051594.1.90091 WP_001051594.1.90095 WP_001051594.1.90131 WP_001051594.1.90145 WP_001051594.1.90148 WP_001051594.1.90161 WP_001051594.1.90173 WP_001051594.1.90174 WP_001051594.1.90180 WP_001051594.1.90215 WP_001051594.1.90217 WP_001051594.1.9022 WP_001051594.1.90243 WP_001051594.1.90246 WP_001051594.1.90250 WP_001051594.1.90253 WP_001051594.1.90276 WP_001051594.1.9030 WP_001051594.1.90331 WP_001051594.1.90345 WP_001051594.1.90367 WP_001051594.1.90370 WP_001051594.1.90386 WP_001051594.1.90447 WP_001051594.1.90454 WP_001051594.1.90473 WP_001051594.1.90475 WP_001051594.1.90488 WP_001051594.1.90506 WP_001051594.1.90533 WP_001051594.1.90544 WP_001051594.1.90554 WP_001051594.1.90604 WP_001051594.1.90647 WP_001051594.1.90660 WP_001051594.1.90661 WP_001051594.1.90683 WP_001051594.1.90698 WP_001051594.1.90726 WP_001051594.1.90728 WP_001051594.1.90738 WP_001051594.1.90740 WP_001051594.1.90745 WP_001051594.1.90757 WP_001051594.1.9076 WP_001051594.1.90801 WP_001051594.1.90804 WP_001051594.1.90818 WP_001051594.1.90820 WP_001051594.1.90861 WP_001051594.1.90896 WP_001051594.1.90903 WP_001051594.1.9100 WP_001051594.1.91005 WP_001051594.1.91011 WP_001051594.1.91019 WP_001051594.1.91054 WP_001051594.1.91126 WP_001051594.1.9114 WP_001051594.1.91150 WP_001051594.1.91158 WP_001051594.1.91177 WP_001051594.1.912 WP_001051594.1.9122 WP_001051594.1.91233 WP_001051594.1.91246 WP_001051594.1.91258 WP_001051594.1.91279 WP_001051594.1.91280 WP_001051594.1.91287 WP_001051594.1.91297 WP_001051594.1.91300 WP_001051594.1.91332 WP_001051594.1.91346 WP_001051594.1.91357 WP_001051594.1.91364 WP_001051594.1.91371 WP_001051594.1.91382 WP_001051594.1.9140 WP_001051594.1.91420 WP_001051594.1.91427 WP_001051594.1.91447 WP_001051594.1.91486 WP_001051594.1.91487 WP_001051594.1.91500 WP_001051594.1.91525 WP_001051594.1.9153 WP_001051594.1.91530 WP_001051594.1.9155 WP_001051594.1.91559 WP_001051594.1.91573 WP_001051594.1.91581 WP_001051594.1.91586 WP_001051594.1.91587 WP_001051594.1.91611 WP_001051594.1.91634 WP_001051594.1.91639 WP_001051594.1.91660 WP_001051594.1.91670 WP_001051594.1.917 WP_001051594.1.91704 WP_001051594.1.91745 WP_001051594.1.91746 WP_001051594.1.91749 WP_001051594.1.91771 WP_001051594.1.91791 WP_001051594.1.91800 WP_001051594.1.91816 WP_001051594.1.91829 WP_001051594.1.91848 WP_001051594.1.91895 WP_001051594.1.91909 WP_001051594.1.91918 WP_001051594.1.91919 WP_001051594.1.91928 WP_001051594.1.91950 WP_001051594.1.91969 WP_001051594.1.92 WP_001051594.1.92055 WP_001051594.1.92080 WP_001051594.1.92115 WP_001051594.1.92125 WP_001051594.1.92133 WP_001051594.1.92140 WP_001051594.1.92143 WP_001051594.1.92147 WP_001051594.1.92164 WP_001051594.1.92169 WP_001051594.1.92173 WP_001051594.1.92185 WP_001051594.1.92186 WP_001051594.1.92196 WP_001051594.1.92212 WP_001051594.1.92228 WP_001051594.1.92244 WP_001051594.1.92249 WP_001051594.1.92253 WP_001051594.1.92254 WP_001051594.1.923 WP_001051594.1.92303 WP_001051594.1.9234 WP_001051594.1.9239 WP_001051594.1.92391 WP_001051594.1.92405 WP_001051594.1.92425 WP_001051594.1.92436 WP_001051594.1.92442 WP_001051594.1.9247 WP_001051594.1.92479 WP_001051594.1.92488 WP_001051594.1.92497 WP_001051594.1.92500 WP_001051594.1.92512 WP_001051594.1.92520 WP_001051594.1.92534 WP_001051594.1.92565 WP_001051594.1.92607 WP_001051594.1.92667 WP_001051594.1.92674 WP_001051594.1.92688 WP_001051594.1.92691 WP_001051594.1.92718 WP_001051594.1.92723 WP_001051594.1.92735 WP_001051594.1.92741 WP_001051594.1.92765 WP_001051594.1.92773 WP_001051594.1.92789 WP_001051594.1.92795 WP_001051594.1.92805 WP_001051594.1.9286 WP_001051594.1.92862 WP_001051594.1.92864 WP_001051594.1.9293 WP_001051594.1.92950 WP_001051594.1.9296 WP_001051594.1.92965 WP_001051594.1.92997 WP_001051594.1.93047 WP_001051594.1.9305 WP_001051594.1.93071 WP_001051594.1.93147 WP_001051594.1.93163 WP_001051594.1.93176 WP_001051594.1.93191 WP_001051594.1.93197 WP_001051594.1.93198 WP_001051594.1.93211 WP_001051594.1.93224 WP_001051594.1.93243 WP_001051594.1.93254 WP_001051594.1.93260 WP_001051594.1.93263 WP_001051594.1.93272 WP_001051594.1.93296 WP_001051594.1.9330 WP_001051594.1.93300 WP_001051594.1.93336 WP_001051594.1.93374 WP_001051594.1.93378 WP_001051594.1.93416 WP_001051594.1.93438 WP_001051594.1.93444 WP_001051594.1.93471 WP_001051594.1.93514 WP_001051594.1.9352 WP_001051594.1.93538 WP_001051594.1.9354 WP_001051594.1.93567 WP_001051594.1.93579 WP_001051594.1.9358 WP_001051594.1.93590 WP_001051594.1.93647 WP_001051594.1.93658 WP_001051594.1.93669 WP_001051594.1.93678 WP_001051594.1.93708 WP_001051594.1.93710 WP_001051594.1.93722 WP_001051594.1.93738 WP_001051594.1.93758 WP_001051594.1.93762 WP_001051594.1.93769 WP_001051594.1.93775 WP_001051594.1.93787 WP_001051594.1.9387 WP_001051594.1.93882 WP_001051594.1.93883 WP_001051594.1.93890 WP_001051594.1.93891 WP_001051594.1.93975 WP_001051594.1.9398 WP_001051594.1.93981 WP_001051594.1.94 WP_001051594.1.94053 WP_001051594.1.94074 WP_001051594.1.9408 WP_001051594.1.94080 WP_001051594.1.94082 WP_001051594.1.94087 WP_001051594.1.94096 WP_001051594.1.9411 WP_001051594.1.94119 WP_001051594.1.94122 WP_001051594.1.94123 WP_001051594.1.94130 WP_001051594.1.94165 WP_001051594.1.94172 WP_001051594.1.94182 WP_001051594.1.94229 WP_001051594.1.94242 WP_001051594.1.94245 WP_001051594.1.94248 WP_001051594.1.94268 WP_001051594.1.94287 WP_001051594.1.94293 WP_001051594.1.94294 WP_001051594.1.9430 WP_001051594.1.94320 WP_001051594.1.94324 WP_001051594.1.94335 WP_001051594.1.94337 WP_001051594.1.94340 WP_001051594.1.94341 WP_001051594.1.9437 WP_001051594.1.94374 WP_001051594.1.94375 WP_001051594.1.94376 WP_001051594.1.94407 WP_001051594.1.94414 WP_001051594.1.94484 WP_001051594.1.94505 WP_001051594.1.94530 WP_001051594.1.94536 WP_001051594.1.9455 WP_001051594.1.94550 WP_001051594.1.94576 WP_001051594.1.94625 WP_001051594.1.9464 WP_001051594.1.94688 WP_001051594.1.947 WP_001051594.1.94719 WP_001051594.1.94733 WP_001051594.1.94741 WP_001051594.1.94789 WP_001051594.1.94797 WP_001051594.1.94825 WP_001051594.1.94838 WP_001051594.1.94844 WP_001051594.1.94845 WP_001051594.1.9485 WP_001051594.1.94857 WP_001051594.1.94866 WP_001051594.1.94969 WP_001051594.1.9497 WP_001051594.1.94980 WP_001051594.1.94989 WP_001051594.1.94999 WP_001051594.1.95002 WP_001051594.1.95008 WP_001051594.1.95023 WP_001051594.1.95029 WP_001051594.1.95033 WP_001051594.1.95038 WP_001051594.1.95075 WP_001051594.1.95077 WP_001051594.1.9510 WP_001051594.1.95120 WP_001051594.1.95156 WP_001051594.1.95193 WP_001051594.1.95210 WP_001051594.1.95263 WP_001051594.1.95281 WP_001051594.1.95294 WP_001051594.1.95318 WP_001051594.1.95327 WP_001051594.1.95342 WP_001051594.1.95361 WP_001051594.1.95372 WP_001051594.1.9538 WP_001051594.1.95386 WP_001051594.1.95415 WP_001051594.1.9544 WP_001051594.1.95442 WP_001051594.1.95476 WP_001051594.1.95494 WP_001051594.1.95512 WP_001051594.1.95519 WP_001051594.1.95522 WP_001051594.1.95535 WP_001051594.1.95537 WP_001051594.1.95550 WP_001051594.1.95552 WP_001051594.1.95560 WP_001051594.1.95581 WP_001051594.1.95603 WP_001051594.1.9563 WP_001051594.1.95639 WP_001051594.1.95640 WP_001051594.1.95681 WP_001051594.1.95683 WP_001051594.1.95699 WP_001051594.1.95713 WP_001051594.1.95714 WP_001051594.1.95737 WP_001051594.1.95760 WP_001051594.1.95780 WP_001051594.1.95804 WP_001051594.1.95806 WP_001051594.1.95832 WP_001051594.1.95877 WP_001051594.1.95885 WP_001051594.1.959 WP_001051594.1.95918 WP_001051594.1.95962 WP_001051594.1.95986 WP_001051594.1.95997 WP_001051594.1.96014 WP_001051594.1.96022 WP_001051594.1.96030 WP_001051594.1.96056 WP_001051594.1.96057 WP_001051594.1.96067 WP_001051594.1.96075 WP_001051594.1.96105 WP_001051594.1.96135 WP_001051594.1.96148 WP_001051594.1.96160 WP_001051594.1.96163 WP_001051594.1.9617 WP_001051594.1.96209 WP_001051594.1.96218 WP_001051594.1.96255 WP_001051594.1.96271 WP_001051594.1.96283 WP_001051594.1.96297 WP_001051594.1.96305 WP_001051594.1.96312 WP_001051594.1.96314 WP_001051594.1.96316 WP_001051594.1.96322 WP_001051594.1.96334 WP_001051594.1.96362 WP_001051594.1.96364 WP_001051594.1.96424 WP_001051594.1.96433 WP_001051594.1.96468 WP_001051594.1.96472 WP_001051594.1.96489 WP_001051594.1.9650 WP_001051594.1.96535 WP_001051594.1.96538 WP_001051594.1.96554 WP_001051594.1.96568 WP_001051594.1.96578 WP_001051594.1.96591 WP_001051594.1.96603 WP_001051594.1.96634 WP_001051594.1.96637 WP_001051594.1.96638 WP_001051594.1.96646 WP_001051594.1.96654 WP_001051594.1.96678 WP_001051594.1.96682 WP_001051594.1.96688 WP_001051594.1.96699 WP_001051594.1.96705 WP_001051594.1.96718 WP_001051594.1.96727 WP_001051594.1.9675 WP_001051594.1.96770 WP_001051594.1.96780 WP_001051594.1.96804 WP_001051594.1.96836 WP_001051594.1.96855 WP_001051594.1.96859 WP_001051594.1.96892 WP_001051594.1.96895 WP_001051594.1.96918 WP_001051594.1.96922 WP_001051594.1.9695 WP_001051594.1.96956 WP_001051594.1.96965 WP_001051594.1.96969 WP_001051594.1.96970 WP_001051594.1.96976 WP_001051594.1.96985 WP_001051594.1.96997 WP_001051594.1.97000 WP_001051594.1.97001 WP_001051594.1.97007 WP_001051594.1.97014 WP_001051594.1.97029 WP_001051594.1.97034 WP_001051594.1.97072 WP_001051594.1.97117 WP_001051594.1.97138 WP_001051594.1.97141 WP_001051594.1.97161 WP_001051594.1.97164 WP_001051594.1.97191 WP_001051594.1.97205 WP_001051594.1.97228 WP_001051594.1.97230 WP_001051594.1.97234 WP_001051594.1.97241 WP_001051594.1.97267 WP_001051594.1.97295 WP_001051594.1.97302 WP_001051594.1.97312 WP_001051594.1.97348 WP_001051594.1.97352 WP_001051594.1.97355 WP_001051594.1.97367 WP_001051594.1.9737 WP_001051594.1.97392 WP_001051594.1.97411 WP_001051594.1.97427 WP_001051594.1.9743 WP_001051594.1.97450 WP_001051594.1.97456 WP_001051594.1.97460 WP_001051594.1.97466 WP_001051594.1.97484 WP_001051594.1.97494 WP_001051594.1.97530 WP_001051594.1.97531 WP_001051594.1.97536 WP_001051594.1.97537 WP_001051594.1.97574 WP_001051594.1.97576 WP_001051594.1.9758 WP_001051594.1.97585 WP_001051594.1.97627 WP_001051594.1.97641 WP_001051594.1.97687 WP_001051594.1.97696 WP_001051594.1.97699 WP_001051594.1.97717 WP_001051594.1.97729 WP_001051594.1.97731 WP_001051594.1.97739 WP_001051594.1.97742 WP_001051594.1.97744 WP_001051594.1.97746 WP_001051594.1.97758 WP_001051594.1.97762 WP_001051594.1.97786 WP_001051594.1.97827 WP_001051594.1.97835 WP_001051594.1.9788 WP_001051594.1.9789 WP_001051594.1.97899 WP_001051594.1.97928 WP_001051594.1.97935 WP_001051594.1.97953 WP_001051594.1.97955 WP_001051594.1.97967 WP_001051594.1.97974 WP_001051594.1.97997 WP_001051594.1.97999 WP_001051594.1.98011 WP_001051594.1.98033 WP_001051594.1.98051 WP_001051594.1.98054 WP_001051594.1.98058 WP_001051594.1.98073 WP_001051594.1.98131 WP_001051594.1.98161 WP_001051594.1.98174 WP_001051594.1.98179 WP_001051594.1.98191 WP_001051594.1.98195 WP_001051594.1.98233 WP_001051594.1.98242 WP_001051594.1.98248 WP_001051594.1.98249 WP_001051594.1.98281 WP_001051594.1.98328 WP_001051594.1.98352 WP_001051594.1.98361 WP_001051594.1.98366 WP_001051594.1.98379 WP_001051594.1.98387 WP_001051594.1.98409 WP_001051594.1.98411 WP_001051594.1.98425 WP_001051594.1.98456 WP_001051594.1.98512 WP_001051594.1.98548 WP_001051594.1.98552 WP_001051594.1.98559 WP_001051594.1.98585 WP_001051594.1.986 WP_001051594.1.98609 WP_001051594.1.98655 WP_001051594.1.98659 WP_001051594.1.98667 WP_001051594.1.98706 WP_001051594.1.98710 WP_001051594.1.9872 WP_001051594.1.98723 WP_001051594.1.98730 WP_001051594.1.98734 WP_001051594.1.98741 WP_001051594.1.98750 WP_001051594.1.98767 WP_001051594.1.98786 WP_001051594.1.98797 WP_001051594.1.98805 WP_001051594.1.98807 WP_001051594.1.98821 WP_001051594.1.98837 WP_001051594.1.98842 WP_001051594.1.98858 WP_001051594.1.98874 WP_001051594.1.98880 WP_001051594.1.98883 WP_001051594.1.98894 WP_001051594.1.98912 WP_001051594.1.98967 WP_001051594.1.98978 WP_001051594.1.98981 WP_001051594.1.98985 WP_001051594.1.99009 WP_001051594.1.99025 WP_001051594.1.99027 WP_001051594.1.9903 WP_001051594.1.99081 WP_001051594.1.991 WP_001051594.1.9910 WP_001051594.1.9912 WP_001051594.1.99136 WP_001051594.1.99155 WP_001051594.1.99171 WP_001051594.1.99174 WP_001051594.1.99207 WP_001051594.1.99217 WP_001051594.1.99228 WP_001051594.1.99237 WP_001051594.1.99249 WP_001051594.1.99280 WP_001051594.1.99283 WP_001051594.1.99308 WP_001051594.1.99331 WP_001051594.1.99359 WP_001051594.1.9936 WP_001051594.1.99405 WP_001051594.1.99414 WP_001051594.1.99418 WP_001051594.1.99430 WP_001051594.1.99459 WP_001051594.1.99492 WP_001051594.1.99494 WP_001051594.1.99509 WP_001051594.1.99519 WP_001051594.1.99523 WP_001051594.1.99536 WP_001051594.1.99538 WP_001051594.1.99564 WP_001051594.1.99569 WP_001051594.1.9960 WP_001051594.1.99631 WP_001051594.1.99638 WP_001051594.1.9965 WP_001051594.1.99683 WP_001051594.1.99686 WP_001051594.1.9974 WP_001051594.1.99759 WP_001051594.1.99802 WP_001051594.1.99830 WP_001051594.1.99849 WP_001051594.1.99850 WP_001051594.1.99859 WP_001051594.1.99860 WP_001051594.1.9987 WP_001051594.1.99884 WP_001051594.1.99888 WP_001051594.1.99926 WP_001051594.1.99954 WP_001051594.1.99955 WP_001051594.1.99956 WP_001051594.1.99979 WP_001051594.1.99984 WP_001051594.1.99985 WP_001051594.1.99999 YP_499126.2.76163 gi|161508811|ref|YP_001574470.1| gi|150393078|ref|YP_001315753.1| gi|387601925|ref|YP_005733446.1| gi|521211389|ref|YP_008167735.1| gi|384861233|ref|YP_005743953.1| gi|404477959|ref|YP_006709389.1| gi|470194668|ref|YP_007581020.1| gi|387142261|ref|YP_005730654.1| gi|479328575|ref|YP_007867634.1| gi|15923561|ref|NP_371095.1| 158878.SAV0571 158879.SA0529 359786.SaurJH9_0594 359787.SaurJH1_0608 418127.SAHV_0569 426430.NWMN_0534 451515.SAUSA300_0556 451516.USA300HOU_0565 681288.SAAV_0534 93061.SAOUHSC_00554 93062.SACOL0618 gi|15926249|ref|NP_373782.1| gi|162138560|ref|YP_493259.2| gi|151220746|ref|YP_001331568.1| gi|470224159|ref|YP_007622738.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]