SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470190969|ref|YP_007577279.1| from Staphylococcus aureus ST228/10388

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470190969|ref|YP_007577279.1|
Domain Number 1 Region: 4-442
Classification Level Classification E-value
Superfamily SIS domain 6.02e-139
Family Phosphoglucose isomerase, PGI 0.0000000000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470190969|ref|YP_007577279.1|
Sequence length 443
Comment Glucose-6-phosphate isomerase [Staphylococcus aureus subsp. aureus ST228]
Sequence
MTHIQLDFSKTLEFFGEHELKQQQEIVKSIHKTIHEGTGAGSDFLGWVDLPVDYDKEEFS
RIVEASKRIKENSDVLVVIGIGGSYLGARAAIEMLTSSFRNSNEYPEIVFVGNHLSSTYT
KELVDYLADKDFSVNVISKSGTTTEPAVAFRLFKQLVEERYGKEEAQKRIFATTDKEKGA
LKQLATNEGYETFIVPDDVGGRYSVLTAVGLLPIATAGINIEAMMIGAAKAREELSSDKL
EDNIAYQYATIRNILYAKGYTTEMLINYEPSMQYFNEWWKQLFGESEGKDFKGIYPSSAN
YTTDLHSLGQYVQEGRRFLFETVVKVNHPKYDITIEKDSDDLDGLNYLAGKTIDEVNTKA
FEGTLLAHTDGGVPNMVVNIPQLDEETFGYVVYFFELACAMSGYQLGVNPFNQPGVEAYK
QNMFALLGKPGFEDLKKELEERL
Download sequence
Identical sequences A0A0E1VLC0 A0A181EKJ0 A7X0H6 P64194 P99078 T1Y7Z0
gi|470222423|ref|YP_007620980.1| gi|384864192|ref|YP_005749551.1| gi|537460623|ref|YP_008491063.1| gi|148267396|ref|YP_001246339.1| gi|470224390|ref|YP_007622969.1| 158878.SAV0962 158879.SA0823 359786.SaurJH9_0962 359787.SaurJH1_0981 418127.SAHV_0957 681288.SAAV_0923 gi|470218602|ref|YP_007618996.1| gi|269202577|ref|YP_003281846.1| gi|470190969|ref|YP_007577279.1| gi|470198832|ref|YP_007585232.1| gi|470192935|ref|YP_007579288.1| gi|387150102|ref|YP_005741666.1| gi|470196865|ref|YP_007583266.1| gi|150393449|ref|YP_001316124.1| WP_000148852.1.10006 WP_000148852.1.10014 WP_000148852.1.100171 WP_000148852.1.100184 WP_000148852.1.100235 WP_000148852.1.100310 WP_000148852.1.10032 WP_000148852.1.100335 WP_000148852.1.100357 WP_000148852.1.100366 WP_000148852.1.100399 WP_000148852.1.10046 WP_000148852.1.100464 WP_000148852.1.10050 WP_000148852.1.100535 WP_000148852.1.100562 WP_000148852.1.100582 WP_000148852.1.100596 WP_000148852.1.100612 WP_000148852.1.100693 WP_000148852.1.100699 WP_000148852.1.100704 WP_000148852.1.100719 WP_000148852.1.100832 WP_000148852.1.100860 WP_000148852.1.100888 WP_000148852.1.100922 WP_000148852.1.100934 WP_000148852.1.10097 WP_000148852.1.101002 WP_000148852.1.101019 WP_000148852.1.101027 WP_000148852.1.101058 WP_000148852.1.101068 WP_000148852.1.101071 WP_000148852.1.101072 WP_000148852.1.10111 WP_000148852.1.101160 WP_000148852.1.101192 WP_000148852.1.101262 WP_000148852.1.101329 WP_000148852.1.101379 WP_000148852.1.101414 WP_000148852.1.101440 WP_000148852.1.101441 WP_000148852.1.10148 WP_000148852.1.101511 WP_000148852.1.101567 WP_000148852.1.101617 WP_000148852.1.10165 WP_000148852.1.101661 WP_000148852.1.101691 WP_000148852.1.101704 WP_000148852.1.101728 WP_000148852.1.101745 WP_000148852.1.101778 WP_000148852.1.101813 WP_000148852.1.101820 WP_000148852.1.101825 WP_000148852.1.101852 WP_000148852.1.101902 WP_000148852.1.101906 WP_000148852.1.101922 WP_000148852.1.101943 WP_000148852.1.102065 WP_000148852.1.102096 WP_000148852.1.102123 WP_000148852.1.102130 WP_000148852.1.102132 WP_000148852.1.10238 WP_000148852.1.1025 WP_000148852.1.10274 WP_000148852.1.1031 WP_000148852.1.10343 WP_000148852.1.10355 WP_000148852.1.1043 WP_000148852.1.10436 WP_000148852.1.10478 WP_000148852.1.10481 WP_000148852.1.1052 WP_000148852.1.10526 WP_000148852.1.10624 WP_000148852.1.10749 WP_000148852.1.10751 WP_000148852.1.1077 WP_000148852.1.10823 WP_000148852.1.10858 WP_000148852.1.1087 WP_000148852.1.10919 WP_000148852.1.10942 WP_000148852.1.10976 WP_000148852.1.10979 WP_000148852.1.10985 WP_000148852.1.11001 WP_000148852.1.11069 WP_000148852.1.11073 WP_000148852.1.11083 WP_000148852.1.11084 WP_000148852.1.1115 WP_000148852.1.11162 WP_000148852.1.11220 WP_000148852.1.11261 WP_000148852.1.11282 WP_000148852.1.11286 WP_000148852.1.11322 WP_000148852.1.11333 WP_000148852.1.11378 WP_000148852.1.11447 WP_000148852.1.11451 WP_000148852.1.1147 WP_000148852.1.11504 WP_000148852.1.11513 WP_000148852.1.11556 WP_000148852.1.11571 WP_000148852.1.11611 WP_000148852.1.11640 WP_000148852.1.11646 WP_000148852.1.11655 WP_000148852.1.11663 WP_000148852.1.1171 WP_000148852.1.11730 WP_000148852.1.11736 WP_000148852.1.11768 WP_000148852.1.11794 WP_000148852.1.11837 WP_000148852.1.11884 WP_000148852.1.11903 WP_000148852.1.12019 WP_000148852.1.12042 WP_000148852.1.1210 WP_000148852.1.12149 WP_000148852.1.12152 WP_000148852.1.12170 WP_000148852.1.12175 WP_000148852.1.12234 WP_000148852.1.12256 WP_000148852.1.12330 WP_000148852.1.12361 WP_000148852.1.12366 WP_000148852.1.12391 WP_000148852.1.12436 WP_000148852.1.12437 WP_000148852.1.12508 WP_000148852.1.1257 WP_000148852.1.12608 WP_000148852.1.12618 WP_000148852.1.12685 WP_000148852.1.12733 WP_000148852.1.12737 WP_000148852.1.12770 WP_000148852.1.12780 WP_000148852.1.12788 WP_000148852.1.12829 WP_000148852.1.12858 WP_000148852.1.12884 WP_000148852.1.12904 WP_000148852.1.12918 WP_000148852.1.12920 WP_000148852.1.13013 WP_000148852.1.13062 WP_000148852.1.13154 WP_000148852.1.13169 WP_000148852.1.13189 WP_000148852.1.13243 WP_000148852.1.13250 WP_000148852.1.13326 WP_000148852.1.13355 WP_000148852.1.13379 WP_000148852.1.13405 WP_000148852.1.13448 WP_000148852.1.13514 WP_000148852.1.13554 WP_000148852.1.13612 WP_000148852.1.13650 WP_000148852.1.13665 WP_000148852.1.13668 WP_000148852.1.13670 WP_000148852.1.13879 WP_000148852.1.13897 WP_000148852.1.13933 WP_000148852.1.13986 WP_000148852.1.13987 WP_000148852.1.14025 WP_000148852.1.14097 WP_000148852.1.14143 WP_000148852.1.14163 WP_000148852.1.1420 WP_000148852.1.14201 WP_000148852.1.1425 WP_000148852.1.1429 WP_000148852.1.14305 WP_000148852.1.14342 WP_000148852.1.14358 WP_000148852.1.14397 WP_000148852.1.14412 WP_000148852.1.14535 WP_000148852.1.14577 WP_000148852.1.14590 WP_000148852.1.14596 WP_000148852.1.14639 WP_000148852.1.14696 WP_000148852.1.1471 WP_000148852.1.14729 WP_000148852.1.14734 WP_000148852.1.14774 WP_000148852.1.14825 WP_000148852.1.14846 WP_000148852.1.14868 WP_000148852.1.14874 WP_000148852.1.14924 WP_000148852.1.14967 WP_000148852.1.14970 WP_000148852.1.15029 WP_000148852.1.15108 WP_000148852.1.15173 WP_000148852.1.15185 WP_000148852.1.1520 WP_000148852.1.15201 WP_000148852.1.1525 WP_000148852.1.15269 WP_000148852.1.15294 WP_000148852.1.15296 WP_000148852.1.15389 WP_000148852.1.15403 WP_000148852.1.15421 WP_000148852.1.15478 WP_000148852.1.15507 WP_000148852.1.15533 WP_000148852.1.15544 WP_000148852.1.15546 WP_000148852.1.1558 WP_000148852.1.15590 WP_000148852.1.1564 WP_000148852.1.1569 WP_000148852.1.15691 WP_000148852.1.15722 WP_000148852.1.15785 WP_000148852.1.15812 WP_000148852.1.159 WP_000148852.1.15920 WP_000148852.1.15921 WP_000148852.1.15925 WP_000148852.1.16018 WP_000148852.1.16068 WP_000148852.1.16096 WP_000148852.1.16098 WP_000148852.1.16140 WP_000148852.1.16173 WP_000148852.1.16195 WP_000148852.1.16203 WP_000148852.1.16223 WP_000148852.1.1623 WP_000148852.1.16251 WP_000148852.1.16265 WP_000148852.1.16276 WP_000148852.1.16311 WP_000148852.1.16407 WP_000148852.1.16458 WP_000148852.1.16589 WP_000148852.1.16632 WP_000148852.1.16639 WP_000148852.1.1665 WP_000148852.1.16651 WP_000148852.1.16653 WP_000148852.1.16693 WP_000148852.1.16747 WP_000148852.1.16761 WP_000148852.1.16794 WP_000148852.1.16815 WP_000148852.1.16824 WP_000148852.1.16880 WP_000148852.1.16882 WP_000148852.1.16920 WP_000148852.1.16925 WP_000148852.1.16969 WP_000148852.1.170 WP_000148852.1.17012 WP_000148852.1.17046 WP_000148852.1.17080 WP_000148852.1.17132 WP_000148852.1.17139 WP_000148852.1.17157 WP_000148852.1.17180 WP_000148852.1.17240 WP_000148852.1.1725 WP_000148852.1.1729 WP_000148852.1.17309 WP_000148852.1.17327 WP_000148852.1.1736 WP_000148852.1.1740 WP_000148852.1.1741 WP_000148852.1.17419 WP_000148852.1.17454 WP_000148852.1.17529 WP_000148852.1.17531 WP_000148852.1.1756 WP_000148852.1.17590 WP_000148852.1.17643 WP_000148852.1.1765 WP_000148852.1.17671 WP_000148852.1.17717 WP_000148852.1.17718 WP_000148852.1.17725 WP_000148852.1.17729 WP_000148852.1.17737 WP_000148852.1.17796 WP_000148852.1.17818 WP_000148852.1.17832 WP_000148852.1.17847 WP_000148852.1.17853 WP_000148852.1.17909 WP_000148852.1.17922 WP_000148852.1.17943 WP_000148852.1.17987 WP_000148852.1.18011 WP_000148852.1.18069 WP_000148852.1.18080 WP_000148852.1.18113 WP_000148852.1.18140 WP_000148852.1.18153 WP_000148852.1.18203 WP_000148852.1.18248 WP_000148852.1.18261 WP_000148852.1.18288 WP_000148852.1.1829 WP_000148852.1.18301 WP_000148852.1.18310 WP_000148852.1.18346 WP_000148852.1.18360 WP_000148852.1.18412 WP_000148852.1.18429 WP_000148852.1.1847 WP_000148852.1.18487 WP_000148852.1.18506 WP_000148852.1.18507 WP_000148852.1.18539 WP_000148852.1.18560 WP_000148852.1.18570 WP_000148852.1.18591 WP_000148852.1.18632 WP_000148852.1.18679 WP_000148852.1.18741 WP_000148852.1.18777 WP_000148852.1.18792 WP_000148852.1.18818 WP_000148852.1.18819 WP_000148852.1.18834 WP_000148852.1.18882 WP_000148852.1.1892 WP_000148852.1.18965 WP_000148852.1.18974 WP_000148852.1.18996 WP_000148852.1.19052 WP_000148852.1.19082 WP_000148852.1.1911 WP_000148852.1.19301 WP_000148852.1.19322 WP_000148852.1.19430 WP_000148852.1.19450 WP_000148852.1.19537 WP_000148852.1.19555 WP_000148852.1.19577 WP_000148852.1.19611 WP_000148852.1.1964 WP_000148852.1.19643 WP_000148852.1.19653 WP_000148852.1.19701 WP_000148852.1.19725 WP_000148852.1.19732 WP_000148852.1.1974 WP_000148852.1.19748 WP_000148852.1.19792 WP_000148852.1.19816 WP_000148852.1.19848 WP_000148852.1.19891 WP_000148852.1.19912 WP_000148852.1.19921 WP_000148852.1.19980 WP_000148852.1.19981 WP_000148852.1.19982 WP_000148852.1.2 WP_000148852.1.20006 WP_000148852.1.20052 WP_000148852.1.2007 WP_000148852.1.20078 WP_000148852.1.2008 WP_000148852.1.20090 WP_000148852.1.20100 WP_000148852.1.20156 WP_000148852.1.20161 WP_000148852.1.20191 WP_000148852.1.20214 WP_000148852.1.20245 WP_000148852.1.20265 WP_000148852.1.2029 WP_000148852.1.20324 WP_000148852.1.20340 WP_000148852.1.20394 WP_000148852.1.20398 WP_000148852.1.20399 WP_000148852.1.20411 WP_000148852.1.20447 WP_000148852.1.20479 WP_000148852.1.20487 WP_000148852.1.20574 WP_000148852.1.20579 WP_000148852.1.20585 WP_000148852.1.20611 WP_000148852.1.20619 WP_000148852.1.20620 WP_000148852.1.20736 WP_000148852.1.20796 WP_000148852.1.20821 WP_000148852.1.20846 WP_000148852.1.20878 WP_000148852.1.20913 WP_000148852.1.20922 WP_000148852.1.20935 WP_000148852.1.20939 WP_000148852.1.20945 WP_000148852.1.20971 WP_000148852.1.21009 WP_000148852.1.21056 WP_000148852.1.21066 WP_000148852.1.21078 WP_000148852.1.21109 WP_000148852.1.21154 WP_000148852.1.21183 WP_000148852.1.2119 WP_000148852.1.21257 WP_000148852.1.21272 WP_000148852.1.21313 WP_000148852.1.21330 WP_000148852.1.21339 WP_000148852.1.2135 WP_000148852.1.21359 WP_000148852.1.21375 WP_000148852.1.21379 WP_000148852.1.21393 WP_000148852.1.21412 WP_000148852.1.21480 WP_000148852.1.21500 WP_000148852.1.21511 WP_000148852.1.21514 WP_000148852.1.21572 WP_000148852.1.2159 WP_000148852.1.2160 WP_000148852.1.21636 WP_000148852.1.21724 WP_000148852.1.21746 WP_000148852.1.21763 WP_000148852.1.21787 WP_000148852.1.21830 WP_000148852.1.21988 WP_000148852.1.22027 WP_000148852.1.22065 WP_000148852.1.22082 WP_000148852.1.22111 WP_000148852.1.22149 WP_000148852.1.22180 WP_000148852.1.22197 WP_000148852.1.22227 WP_000148852.1.22302 WP_000148852.1.22369 WP_000148852.1.22400 WP_000148852.1.22493 WP_000148852.1.22531 WP_000148852.1.22533 WP_000148852.1.22559 WP_000148852.1.22650 WP_000148852.1.22696 WP_000148852.1.22702 WP_000148852.1.22709 WP_000148852.1.22738 WP_000148852.1.22789 WP_000148852.1.22790 WP_000148852.1.22792 WP_000148852.1.22803 WP_000148852.1.22853 WP_000148852.1.22869 WP_000148852.1.22890 WP_000148852.1.22924 WP_000148852.1.22969 WP_000148852.1.23008 WP_000148852.1.23048 WP_000148852.1.23061 WP_000148852.1.23082 WP_000148852.1.23103 WP_000148852.1.23121 WP_000148852.1.23130 WP_000148852.1.23132 WP_000148852.1.23133 WP_000148852.1.23161 WP_000148852.1.23185 WP_000148852.1.23197 WP_000148852.1.23244 WP_000148852.1.2327 WP_000148852.1.23275 WP_000148852.1.23288 WP_000148852.1.23413 WP_000148852.1.23449 WP_000148852.1.23531 WP_000148852.1.23572 WP_000148852.1.23630 WP_000148852.1.23644 WP_000148852.1.23690 WP_000148852.1.23740 WP_000148852.1.23796 WP_000148852.1.23809 WP_000148852.1.23842 WP_000148852.1.2389 WP_000148852.1.23900 WP_000148852.1.23944 WP_000148852.1.23956 WP_000148852.1.23972 WP_000148852.1.23995 WP_000148852.1.24000 WP_000148852.1.24129 WP_000148852.1.24174 WP_000148852.1.24207 WP_000148852.1.24213 WP_000148852.1.24263 WP_000148852.1.2427 WP_000148852.1.24277 WP_000148852.1.24343 WP_000148852.1.24416 WP_000148852.1.24437 WP_000148852.1.24462 WP_000148852.1.24469 WP_000148852.1.2450 WP_000148852.1.24519 WP_000148852.1.24589 WP_000148852.1.24596 WP_000148852.1.24602 WP_000148852.1.24631 WP_000148852.1.24684 WP_000148852.1.24685 WP_000148852.1.24823 WP_000148852.1.24855 WP_000148852.1.24903 WP_000148852.1.2497 WP_000148852.1.25007 WP_000148852.1.2501 WP_000148852.1.25012 WP_000148852.1.2506 WP_000148852.1.25070 WP_000148852.1.25092 WP_000148852.1.25098 WP_000148852.1.25115 WP_000148852.1.25120 WP_000148852.1.25145 WP_000148852.1.25167 WP_000148852.1.25209 WP_000148852.1.25262 WP_000148852.1.25287 WP_000148852.1.25361 WP_000148852.1.25433 WP_000148852.1.25459 WP_000148852.1.25489 WP_000148852.1.2552 WP_000148852.1.25557 WP_000148852.1.25595 WP_000148852.1.25621 WP_000148852.1.25623 WP_000148852.1.25721 WP_000148852.1.25758 WP_000148852.1.25772 WP_000148852.1.25779 WP_000148852.1.25802 WP_000148852.1.25840 WP_000148852.1.25856 WP_000148852.1.25857 WP_000148852.1.2590 WP_000148852.1.25910 WP_000148852.1.2592 WP_000148852.1.25930 WP_000148852.1.26039 WP_000148852.1.2608 WP_000148852.1.26086 WP_000148852.1.26106 WP_000148852.1.26143 WP_000148852.1.26169 WP_000148852.1.2621 WP_000148852.1.26255 WP_000148852.1.26266 WP_000148852.1.26276 WP_000148852.1.26290 WP_000148852.1.26298 WP_000148852.1.26314 WP_000148852.1.26318 WP_000148852.1.2633 WP_000148852.1.26340 WP_000148852.1.26345 WP_000148852.1.26346 WP_000148852.1.26354 WP_000148852.1.26359 WP_000148852.1.26364 WP_000148852.1.26399 WP_000148852.1.26404 WP_000148852.1.2643 WP_000148852.1.26506 WP_000148852.1.26662 WP_000148852.1.26677 WP_000148852.1.26692 WP_000148852.1.2673 WP_000148852.1.26751 WP_000148852.1.26772 WP_000148852.1.26804 WP_000148852.1.2684 WP_000148852.1.26840 WP_000148852.1.26865 WP_000148852.1.26884 WP_000148852.1.2689 WP_000148852.1.26903 WP_000148852.1.26905 WP_000148852.1.26938 WP_000148852.1.26944 WP_000148852.1.27013 WP_000148852.1.27053 WP_000148852.1.27166 WP_000148852.1.27170 WP_000148852.1.2718 WP_000148852.1.27182 WP_000148852.1.2719 WP_000148852.1.27207 WP_000148852.1.2725 WP_000148852.1.27262 WP_000148852.1.27293 WP_000148852.1.27294 WP_000148852.1.27323 WP_000148852.1.27379 WP_000148852.1.27387 WP_000148852.1.27447 WP_000148852.1.27456 WP_000148852.1.27468 WP_000148852.1.2753 WP_000148852.1.27539 WP_000148852.1.27590 WP_000148852.1.27628 WP_000148852.1.27640 WP_000148852.1.27646 WP_000148852.1.27689 WP_000148852.1.27744 WP_000148852.1.27765 WP_000148852.1.27793 WP_000148852.1.2795 WP_000148852.1.28016 WP_000148852.1.28091 WP_000148852.1.28105 WP_000148852.1.28173 WP_000148852.1.28213 WP_000148852.1.28226 WP_000148852.1.28230 WP_000148852.1.28253 WP_000148852.1.28257 WP_000148852.1.28315 WP_000148852.1.28319 WP_000148852.1.28334 WP_000148852.1.28347 WP_000148852.1.28400 WP_000148852.1.28430 WP_000148852.1.2852 WP_000148852.1.28578 WP_000148852.1.28580 WP_000148852.1.28605 WP_000148852.1.28652 WP_000148852.1.28720 WP_000148852.1.28763 WP_000148852.1.28784 WP_000148852.1.28785 WP_000148852.1.28848 WP_000148852.1.28871 WP_000148852.1.28909 WP_000148852.1.28981 WP_000148852.1.28987 WP_000148852.1.29052 WP_000148852.1.29060 WP_000148852.1.29112 WP_000148852.1.29155 WP_000148852.1.29166 WP_000148852.1.29187 WP_000148852.1.29226 WP_000148852.1.29242 WP_000148852.1.29243 WP_000148852.1.29263 WP_000148852.1.29276 WP_000148852.1.29329 WP_000148852.1.29366 WP_000148852.1.29368 WP_000148852.1.29395 WP_000148852.1.29420 WP_000148852.1.29468 WP_000148852.1.29522 WP_000148852.1.29553 WP_000148852.1.29554 WP_000148852.1.2957 WP_000148852.1.2972 WP_000148852.1.29736 WP_000148852.1.29744 WP_000148852.1.29788 WP_000148852.1.2981 WP_000148852.1.29862 WP_000148852.1.29902 WP_000148852.1.29905 WP_000148852.1.29918 WP_000148852.1.29981 WP_000148852.1.30051 WP_000148852.1.30089 WP_000148852.1.30095 WP_000148852.1.30100 WP_000148852.1.30115 WP_000148852.1.30152 WP_000148852.1.30197 WP_000148852.1.30204 WP_000148852.1.30209 WP_000148852.1.30249 WP_000148852.1.30302 WP_000148852.1.30307 WP_000148852.1.30328 WP_000148852.1.30350 WP_000148852.1.30364 WP_000148852.1.30508 WP_000148852.1.30531 WP_000148852.1.30560 WP_000148852.1.30622 WP_000148852.1.30645 WP_000148852.1.30646 WP_000148852.1.30666 WP_000148852.1.30702 WP_000148852.1.30720 WP_000148852.1.30726 WP_000148852.1.30763 WP_000148852.1.3077 WP_000148852.1.30845 WP_000148852.1.30846 WP_000148852.1.30847 WP_000148852.1.30911 WP_000148852.1.30962 WP_000148852.1.31005 WP_000148852.1.31022 WP_000148852.1.31039 WP_000148852.1.31048 WP_000148852.1.31091 WP_000148852.1.31176 WP_000148852.1.31206 WP_000148852.1.3123 WP_000148852.1.31315 WP_000148852.1.3132 WP_000148852.1.31337 WP_000148852.1.31339 WP_000148852.1.31355 WP_000148852.1.31437 WP_000148852.1.31442 WP_000148852.1.31468 WP_000148852.1.31479 WP_000148852.1.31529 WP_000148852.1.31539 WP_000148852.1.31642 WP_000148852.1.31647 WP_000148852.1.31653 WP_000148852.1.31686 WP_000148852.1.31753 WP_000148852.1.31827 WP_000148852.1.31828 WP_000148852.1.31842 WP_000148852.1.31892 WP_000148852.1.31997 WP_000148852.1.32003 WP_000148852.1.32005 WP_000148852.1.32029 WP_000148852.1.32067 WP_000148852.1.32160 WP_000148852.1.32207 WP_000148852.1.3229 WP_000148852.1.32339 WP_000148852.1.32474 WP_000148852.1.32481 WP_000148852.1.32483 WP_000148852.1.32514 WP_000148852.1.32534 WP_000148852.1.32555 WP_000148852.1.32565 WP_000148852.1.32607 WP_000148852.1.32634 WP_000148852.1.32645 WP_000148852.1.32746 WP_000148852.1.32764 WP_000148852.1.32770 WP_000148852.1.32800 WP_000148852.1.32928 WP_000148852.1.32939 WP_000148852.1.32954 WP_000148852.1.33038 WP_000148852.1.33048 WP_000148852.1.33067 WP_000148852.1.33110 WP_000148852.1.33123 WP_000148852.1.33138 WP_000148852.1.33212 WP_000148852.1.33250 WP_000148852.1.33266 WP_000148852.1.33296 WP_000148852.1.33335 WP_000148852.1.33357 WP_000148852.1.33416 WP_000148852.1.3342 WP_000148852.1.33432 WP_000148852.1.33468 WP_000148852.1.3347 WP_000148852.1.33507 WP_000148852.1.33626 WP_000148852.1.33627 WP_000148852.1.3363 WP_000148852.1.33654 WP_000148852.1.33692 WP_000148852.1.33695 WP_000148852.1.33718 WP_000148852.1.33735 WP_000148852.1.33743 WP_000148852.1.33769 WP_000148852.1.33792 WP_000148852.1.33804 WP_000148852.1.33813 WP_000148852.1.33940 WP_000148852.1.33968 WP_000148852.1.33971 WP_000148852.1.33983 WP_000148852.1.34026 WP_000148852.1.34030 WP_000148852.1.34051 WP_000148852.1.34062 WP_000148852.1.34100 WP_000148852.1.34128 WP_000148852.1.34132 WP_000148852.1.34168 WP_000148852.1.34182 WP_000148852.1.34209 WP_000148852.1.34244 WP_000148852.1.34250 WP_000148852.1.34251 WP_000148852.1.34285 WP_000148852.1.34381 WP_000148852.1.34403 WP_000148852.1.34410 WP_000148852.1.34436 WP_000148852.1.34482 WP_000148852.1.34492 WP_000148852.1.34502 WP_000148852.1.34510 WP_000148852.1.34526 WP_000148852.1.3461 WP_000148852.1.34677 WP_000148852.1.34737 WP_000148852.1.34767 WP_000148852.1.34818 WP_000148852.1.34890 WP_000148852.1.34918 WP_000148852.1.34998 WP_000148852.1.35059 WP_000148852.1.35089 WP_000148852.1.35110 WP_000148852.1.35121 WP_000148852.1.35233 WP_000148852.1.35276 WP_000148852.1.35285 WP_000148852.1.35297 WP_000148852.1.35334 WP_000148852.1.35342 WP_000148852.1.354 WP_000148852.1.35415 WP_000148852.1.3542 WP_000148852.1.3547 WP_000148852.1.35498 WP_000148852.1.35525 WP_000148852.1.35580 WP_000148852.1.35615 WP_000148852.1.35623 WP_000148852.1.35673 WP_000148852.1.3569 WP_000148852.1.35801 WP_000148852.1.35826 WP_000148852.1.35888 WP_000148852.1.35900 WP_000148852.1.35928 WP_000148852.1.35950 WP_000148852.1.36004 WP_000148852.1.36082 WP_000148852.1.36102 WP_000148852.1.36119 WP_000148852.1.36141 WP_000148852.1.3617 WP_000148852.1.36176 WP_000148852.1.36187 WP_000148852.1.36188 WP_000148852.1.36250 WP_000148852.1.36264 WP_000148852.1.36278 WP_000148852.1.36282 WP_000148852.1.36307 WP_000148852.1.36344 WP_000148852.1.36389 WP_000148852.1.36532 WP_000148852.1.36535 WP_000148852.1.3655 WP_000148852.1.36570 WP_000148852.1.36580 WP_000148852.1.36600 WP_000148852.1.36615 WP_000148852.1.36646 WP_000148852.1.3666 WP_000148852.1.36689 WP_000148852.1.36697 WP_000148852.1.36745 WP_000148852.1.3675 WP_000148852.1.36783 WP_000148852.1.36822 WP_000148852.1.3685 WP_000148852.1.3687 WP_000148852.1.36955 WP_000148852.1.36979 WP_000148852.1.36980 WP_000148852.1.36997 WP_000148852.1.37002 WP_000148852.1.37016 WP_000148852.1.3703 WP_000148852.1.37044 WP_000148852.1.37055 WP_000148852.1.37080 WP_000148852.1.37121 WP_000148852.1.37134 WP_000148852.1.37220 WP_000148852.1.37341 WP_000148852.1.37398 WP_000148852.1.37424 WP_000148852.1.37467 WP_000148852.1.37503 WP_000148852.1.37583 WP_000148852.1.37602 WP_000148852.1.37605 WP_000148852.1.37606 WP_000148852.1.37621 WP_000148852.1.37624 WP_000148852.1.3776 WP_000148852.1.37781 WP_000148852.1.37828 WP_000148852.1.37953 WP_000148852.1.37987 WP_000148852.1.38038 WP_000148852.1.38057 WP_000148852.1.38070 WP_000148852.1.38082 WP_000148852.1.3809 WP_000148852.1.38160 WP_000148852.1.38177 WP_000148852.1.3820 WP_000148852.1.38230 WP_000148852.1.38232 WP_000148852.1.38276 WP_000148852.1.38282 WP_000148852.1.38309 WP_000148852.1.38339 WP_000148852.1.38383 WP_000148852.1.3842 WP_000148852.1.38437 WP_000148852.1.38453 WP_000148852.1.38493 WP_000148852.1.3852 WP_000148852.1.38546 WP_000148852.1.38607 WP_000148852.1.38612 WP_000148852.1.3867 WP_000148852.1.38674 WP_000148852.1.38721 WP_000148852.1.38760 WP_000148852.1.38823 WP_000148852.1.38841 WP_000148852.1.38858 WP_000148852.1.38926 WP_000148852.1.38931 WP_000148852.1.38940 WP_000148852.1.38941 WP_000148852.1.38972 WP_000148852.1.38989 WP_000148852.1.390 WP_000148852.1.39012 WP_000148852.1.39014 WP_000148852.1.39043 WP_000148852.1.39053 WP_000148852.1.3906 WP_000148852.1.391 WP_000148852.1.39108 WP_000148852.1.39173 WP_000148852.1.39203 WP_000148852.1.39206 WP_000148852.1.39217 WP_000148852.1.3926 WP_000148852.1.39272 WP_000148852.1.39290 WP_000148852.1.39332 WP_000148852.1.39333 WP_000148852.1.39406 WP_000148852.1.39451 WP_000148852.1.39486 WP_000148852.1.39506 WP_000148852.1.39550 WP_000148852.1.39645 WP_000148852.1.39687 WP_000148852.1.39689 WP_000148852.1.39697 WP_000148852.1.39711 WP_000148852.1.39738 WP_000148852.1.39767 WP_000148852.1.39789 WP_000148852.1.39832 WP_000148852.1.39838 WP_000148852.1.39856 WP_000148852.1.40014 WP_000148852.1.40043 WP_000148852.1.40099 WP_000148852.1.40120 WP_000148852.1.40137 WP_000148852.1.4015 WP_000148852.1.40164 WP_000148852.1.40173 WP_000148852.1.4019 WP_000148852.1.40318 WP_000148852.1.40320 WP_000148852.1.40330 WP_000148852.1.40340 WP_000148852.1.40368 WP_000148852.1.40406 WP_000148852.1.4045 WP_000148852.1.40472 WP_000148852.1.40474 WP_000148852.1.40481 WP_000148852.1.40505 WP_000148852.1.40531 WP_000148852.1.40532 WP_000148852.1.4056 WP_000148852.1.4057 WP_000148852.1.40579 WP_000148852.1.40588 WP_000148852.1.40620 WP_000148852.1.40644 WP_000148852.1.40655 WP_000148852.1.40658 WP_000148852.1.40659 WP_000148852.1.40760 WP_000148852.1.40797 WP_000148852.1.40816 WP_000148852.1.41064 WP_000148852.1.41084 WP_000148852.1.41094 WP_000148852.1.41119 WP_000148852.1.41129 WP_000148852.1.4115 WP_000148852.1.41178 WP_000148852.1.41208 WP_000148852.1.41241 WP_000148852.1.41255 WP_000148852.1.41289 WP_000148852.1.4129 WP_000148852.1.41432 WP_000148852.1.41433 WP_000148852.1.41499 WP_000148852.1.41511 WP_000148852.1.41558 WP_000148852.1.41567 WP_000148852.1.41582 WP_000148852.1.41623 WP_000148852.1.41647 WP_000148852.1.41674 WP_000148852.1.41839 WP_000148852.1.4188 WP_000148852.1.41898 WP_000148852.1.41935 WP_000148852.1.41989 WP_000148852.1.420 WP_000148852.1.42015 WP_000148852.1.42017 WP_000148852.1.42028 WP_000148852.1.42064 WP_000148852.1.42087 WP_000148852.1.42125 WP_000148852.1.42137 WP_000148852.1.42198 WP_000148852.1.42269 WP_000148852.1.42305 WP_000148852.1.42355 WP_000148852.1.42403 WP_000148852.1.42436 WP_000148852.1.42459 WP_000148852.1.42481 WP_000148852.1.42510 WP_000148852.1.42593 WP_000148852.1.426 WP_000148852.1.42640 WP_000148852.1.42652 WP_000148852.1.42668 WP_000148852.1.42674 WP_000148852.1.42679 WP_000148852.1.42737 WP_000148852.1.42759 WP_000148852.1.42786 WP_000148852.1.42837 WP_000148852.1.42897 WP_000148852.1.4293 WP_000148852.1.4299 WP_000148852.1.43014 WP_000148852.1.43047 WP_000148852.1.43072 WP_000148852.1.43122 WP_000148852.1.43131 WP_000148852.1.43134 WP_000148852.1.43147 WP_000148852.1.43159 WP_000148852.1.43165 WP_000148852.1.43202 WP_000148852.1.43232 WP_000148852.1.43248 WP_000148852.1.4325 WP_000148852.1.43263 WP_000148852.1.4327 WP_000148852.1.43323 WP_000148852.1.43341 WP_000148852.1.43349 WP_000148852.1.43369 WP_000148852.1.4337 WP_000148852.1.43406 WP_000148852.1.4341 WP_000148852.1.43410 WP_000148852.1.43460 WP_000148852.1.4347 WP_000148852.1.43550 WP_000148852.1.43560 WP_000148852.1.43617 WP_000148852.1.43618 WP_000148852.1.43627 WP_000148852.1.43659 WP_000148852.1.43670 WP_000148852.1.43703 WP_000148852.1.4372 WP_000148852.1.43731 WP_000148852.1.43752 WP_000148852.1.43788 WP_000148852.1.43819 WP_000148852.1.43827 WP_000148852.1.4385 WP_000148852.1.43904 WP_000148852.1.43915 WP_000148852.1.43984 WP_000148852.1.44119 WP_000148852.1.44153 WP_000148852.1.44181 WP_000148852.1.44195 WP_000148852.1.44265 WP_000148852.1.44302 WP_000148852.1.44388 WP_000148852.1.44396 WP_000148852.1.44405 WP_000148852.1.44420 WP_000148852.1.44517 WP_000148852.1.44544 WP_000148852.1.44579 WP_000148852.1.44588 WP_000148852.1.44605 WP_000148852.1.44631 WP_000148852.1.44672 WP_000148852.1.44755 WP_000148852.1.44780 WP_000148852.1.44785 WP_000148852.1.44788 WP_000148852.1.44796 WP_000148852.1.44881 WP_000148852.1.44882 WP_000148852.1.44914 WP_000148852.1.44955 WP_000148852.1.45033 WP_000148852.1.45035 WP_000148852.1.45099 WP_000148852.1.4513 WP_000148852.1.45133 WP_000148852.1.45164 WP_000148852.1.45170 WP_000148852.1.45272 WP_000148852.1.45290 WP_000148852.1.45297 WP_000148852.1.453 WP_000148852.1.45364 WP_000148852.1.45419 WP_000148852.1.45431 WP_000148852.1.45472 WP_000148852.1.4550 WP_000148852.1.45507 WP_000148852.1.45560 WP_000148852.1.45577 WP_000148852.1.45654 WP_000148852.1.45670 WP_000148852.1.45698 WP_000148852.1.45703 WP_000148852.1.45730 WP_000148852.1.45734 WP_000148852.1.45768 WP_000148852.1.45771 WP_000148852.1.45780 WP_000148852.1.4584 WP_000148852.1.45852 WP_000148852.1.45897 WP_000148852.1.45954 WP_000148852.1.4598 WP_000148852.1.46003 WP_000148852.1.46005 WP_000148852.1.46087 WP_000148852.1.46168 WP_000148852.1.46208 WP_000148852.1.46222 WP_000148852.1.46228 WP_000148852.1.46276 WP_000148852.1.46330 WP_000148852.1.46334 WP_000148852.1.46362 WP_000148852.1.46368 WP_000148852.1.46380 WP_000148852.1.46389 WP_000148852.1.46401 WP_000148852.1.46422 WP_000148852.1.46465 WP_000148852.1.46543 WP_000148852.1.4662 WP_000148852.1.46660 WP_000148852.1.46664 WP_000148852.1.46670 WP_000148852.1.46692 WP_000148852.1.46702 WP_000148852.1.46703 WP_000148852.1.46752 WP_000148852.1.46765 WP_000148852.1.46852 WP_000148852.1.46908 WP_000148852.1.46911 WP_000148852.1.46925 WP_000148852.1.46937 WP_000148852.1.4696 WP_000148852.1.46983 WP_000148852.1.47051 WP_000148852.1.47065 WP_000148852.1.47128 WP_000148852.1.47153 WP_000148852.1.47159 WP_000148852.1.47163 WP_000148852.1.47175 WP_000148852.1.47187 WP_000148852.1.47193 WP_000148852.1.47211 WP_000148852.1.47216 WP_000148852.1.47258 WP_000148852.1.47269 WP_000148852.1.47279 WP_000148852.1.4728 WP_000148852.1.47290 WP_000148852.1.47294 WP_000148852.1.47306 WP_000148852.1.47328 WP_000148852.1.47399 WP_000148852.1.47406 WP_000148852.1.47426 WP_000148852.1.47432 WP_000148852.1.47439 WP_000148852.1.47450 WP_000148852.1.47560 WP_000148852.1.47618 WP_000148852.1.4767 WP_000148852.1.477 WP_000148852.1.47702 WP_000148852.1.47733 WP_000148852.1.47763 WP_000148852.1.47782 WP_000148852.1.47835 WP_000148852.1.47836 WP_000148852.1.47859 WP_000148852.1.47864 WP_000148852.1.47872 WP_000148852.1.47873 WP_000148852.1.47904 WP_000148852.1.47996 WP_000148852.1.48011 WP_000148852.1.48030 WP_000148852.1.48047 WP_000148852.1.4805 WP_000148852.1.48149 WP_000148852.1.48154 WP_000148852.1.48169 WP_000148852.1.48186 WP_000148852.1.48205 WP_000148852.1.48227 WP_000148852.1.48236 WP_000148852.1.48250 WP_000148852.1.48284 WP_000148852.1.48293 WP_000148852.1.48307 WP_000148852.1.48322 WP_000148852.1.48391 WP_000148852.1.48394 WP_000148852.1.48463 WP_000148852.1.48563 WP_000148852.1.48577 WP_000148852.1.48593 WP_000148852.1.48634 WP_000148852.1.48656 WP_000148852.1.4868 WP_000148852.1.48705 WP_000148852.1.48805 WP_000148852.1.48817 WP_000148852.1.48823 WP_000148852.1.48833 WP_000148852.1.48835 WP_000148852.1.4886 WP_000148852.1.48936 WP_000148852.1.48941 WP_000148852.1.48945 WP_000148852.1.48951 WP_000148852.1.48968 WP_000148852.1.48982 WP_000148852.1.48993 WP_000148852.1.4901 WP_000148852.1.49032 WP_000148852.1.4905 WP_000148852.1.49128 WP_000148852.1.49129 WP_000148852.1.49159 WP_000148852.1.4916 WP_000148852.1.49161 WP_000148852.1.4917 WP_000148852.1.4918 WP_000148852.1.49207 WP_000148852.1.49248 WP_000148852.1.49327 WP_000148852.1.49398 WP_000148852.1.49479 WP_000148852.1.4950 WP_000148852.1.49539 WP_000148852.1.4962 WP_000148852.1.49653 WP_000148852.1.49669 WP_000148852.1.49730 WP_000148852.1.49742 WP_000148852.1.4980 WP_000148852.1.4982 WP_000148852.1.49860 WP_000148852.1.49863 WP_000148852.1.49871 WP_000148852.1.4989 WP_000148852.1.49894 WP_000148852.1.49907 WP_000148852.1.49934 WP_000148852.1.4994 WP_000148852.1.49970 WP_000148852.1.49982 WP_000148852.1.50013 WP_000148852.1.50038 WP_000148852.1.50039 WP_000148852.1.50061 WP_000148852.1.50076 WP_000148852.1.5013 WP_000148852.1.50138 WP_000148852.1.50217 WP_000148852.1.50219 WP_000148852.1.50261 WP_000148852.1.50313 WP_000148852.1.50314 WP_000148852.1.50356 WP_000148852.1.50369 WP_000148852.1.50425 WP_000148852.1.50430 WP_000148852.1.50477 WP_000148852.1.50536 WP_000148852.1.50555 WP_000148852.1.50578 WP_000148852.1.50595 WP_000148852.1.50660 WP_000148852.1.50768 WP_000148852.1.50799 WP_000148852.1.50820 WP_000148852.1.5087 WP_000148852.1.50884 WP_000148852.1.50896 WP_000148852.1.50937 WP_000148852.1.50962 WP_000148852.1.5109 WP_000148852.1.5110 WP_000148852.1.5111 WP_000148852.1.51152 WP_000148852.1.51236 WP_000148852.1.51245 WP_000148852.1.51250 WP_000148852.1.51282 WP_000148852.1.51295 WP_000148852.1.51306 WP_000148852.1.51310 WP_000148852.1.51346 WP_000148852.1.51376 WP_000148852.1.51403 WP_000148852.1.51454 WP_000148852.1.51456 WP_000148852.1.51492 WP_000148852.1.515 WP_000148852.1.51527 WP_000148852.1.5155 WP_000148852.1.51559 WP_000148852.1.51575 WP_000148852.1.51590 WP_000148852.1.51665 WP_000148852.1.51716 WP_000148852.1.51744 WP_000148852.1.51748 WP_000148852.1.51797 WP_000148852.1.51836 WP_000148852.1.51842 WP_000148852.1.51844 WP_000148852.1.51871 WP_000148852.1.51883 WP_000148852.1.51912 WP_000148852.1.51924 WP_000148852.1.51936 WP_000148852.1.51952 WP_000148852.1.51971 WP_000148852.1.51995 WP_000148852.1.52078 WP_000148852.1.521 WP_000148852.1.5213 WP_000148852.1.52151 WP_000148852.1.52182 WP_000148852.1.52185 WP_000148852.1.52193 WP_000148852.1.52224 WP_000148852.1.52251 WP_000148852.1.52296 WP_000148852.1.523 WP_000148852.1.5231 WP_000148852.1.52322 WP_000148852.1.52327 WP_000148852.1.52331 WP_000148852.1.52340 WP_000148852.1.52440 WP_000148852.1.52442 WP_000148852.1.52463 WP_000148852.1.52518 WP_000148852.1.52548 WP_000148852.1.52595 WP_000148852.1.52623 WP_000148852.1.52624 WP_000148852.1.52633 WP_000148852.1.52645 WP_000148852.1.52670 WP_000148852.1.52687 WP_000148852.1.52699 WP_000148852.1.52715 WP_000148852.1.52722 WP_000148852.1.52848 WP_000148852.1.52877 WP_000148852.1.52878 WP_000148852.1.52941 WP_000148852.1.52947 WP_000148852.1.53002 WP_000148852.1.53071 WP_000148852.1.53140 WP_000148852.1.53153 WP_000148852.1.53178 WP_000148852.1.53209 WP_000148852.1.53260 WP_000148852.1.53319 WP_000148852.1.53387 WP_000148852.1.53394 WP_000148852.1.53403 WP_000148852.1.53432 WP_000148852.1.53462 WP_000148852.1.53521 WP_000148852.1.53577 WP_000148852.1.53641 WP_000148852.1.53648 WP_000148852.1.53671 WP_000148852.1.53691 WP_000148852.1.53759 WP_000148852.1.53766 WP_000148852.1.53827 WP_000148852.1.53835 WP_000148852.1.53889 WP_000148852.1.53915 WP_000148852.1.53934 WP_000148852.1.53969 WP_000148852.1.53999 WP_000148852.1.5401 WP_000148852.1.54022 WP_000148852.1.54109 WP_000148852.1.54147 WP_000148852.1.54229 WP_000148852.1.54253 WP_000148852.1.54297 WP_000148852.1.54395 WP_000148852.1.544 WP_000148852.1.54413 WP_000148852.1.54491 WP_000148852.1.54503 WP_000148852.1.54510 WP_000148852.1.54543 WP_000148852.1.54551 WP_000148852.1.54637 WP_000148852.1.54675 WP_000148852.1.5469 WP_000148852.1.54745 WP_000148852.1.54753 WP_000148852.1.54878 WP_000148852.1.54955 WP_000148852.1.55014 WP_000148852.1.55058 WP_000148852.1.55100 WP_000148852.1.5519 WP_000148852.1.55214 WP_000148852.1.55272 WP_000148852.1.55274 WP_000148852.1.55309 WP_000148852.1.55367 WP_000148852.1.55369 WP_000148852.1.55403 WP_000148852.1.55405 WP_000148852.1.55421 WP_000148852.1.55508 WP_000148852.1.5554 WP_000148852.1.55544 WP_000148852.1.55558 WP_000148852.1.5556 WP_000148852.1.55583 WP_000148852.1.5559 WP_000148852.1.5562 WP_000148852.1.55628 WP_000148852.1.55637 WP_000148852.1.55653 WP_000148852.1.557 WP_000148852.1.55728 WP_000148852.1.55784 WP_000148852.1.55786 WP_000148852.1.5580 WP_000148852.1.55818 WP_000148852.1.55831 WP_000148852.1.55835 WP_000148852.1.55867 WP_000148852.1.55886 WP_000148852.1.5589 WP_000148852.1.55904 WP_000148852.1.55916 WP_000148852.1.55933 WP_000148852.1.55953 WP_000148852.1.56000 WP_000148852.1.56025 WP_000148852.1.56048 WP_000148852.1.56078 WP_000148852.1.56098 WP_000148852.1.56225 WP_000148852.1.5623 WP_000148852.1.56239 WP_000148852.1.56281 WP_000148852.1.56332 WP_000148852.1.56333 WP_000148852.1.5635 WP_000148852.1.5637 WP_000148852.1.56400 WP_000148852.1.5644 WP_000148852.1.56558 WP_000148852.1.5658 WP_000148852.1.56584 WP_000148852.1.56598 WP_000148852.1.566 WP_000148852.1.56628 WP_000148852.1.56641 WP_000148852.1.56658 WP_000148852.1.5666 WP_000148852.1.56767 WP_000148852.1.5677 WP_000148852.1.56778 WP_000148852.1.56794 WP_000148852.1.56815 WP_000148852.1.56856 WP_000148852.1.56865 WP_000148852.1.56878 WP_000148852.1.569 WP_000148852.1.56986 WP_000148852.1.57047 WP_000148852.1.57073 WP_000148852.1.57075 WP_000148852.1.57097 WP_000148852.1.57109 WP_000148852.1.57170 WP_000148852.1.5718 WP_000148852.1.57190 WP_000148852.1.57214 WP_000148852.1.57265 WP_000148852.1.57309 WP_000148852.1.57445 WP_000148852.1.57481 WP_000148852.1.57594 WP_000148852.1.57650 WP_000148852.1.57665 WP_000148852.1.57682 WP_000148852.1.57692 WP_000148852.1.57730 WP_000148852.1.57734 WP_000148852.1.57754 WP_000148852.1.57808 WP_000148852.1.57819 WP_000148852.1.57837 WP_000148852.1.57840 WP_000148852.1.57861 WP_000148852.1.57878 WP_000148852.1.57952 WP_000148852.1.57974 WP_000148852.1.58016 WP_000148852.1.58035 WP_000148852.1.58049 WP_000148852.1.58074 WP_000148852.1.58116 WP_000148852.1.58127 WP_000148852.1.58148 WP_000148852.1.58158 WP_000148852.1.5816 WP_000148852.1.58277 WP_000148852.1.58317 WP_000148852.1.58352 WP_000148852.1.58364 WP_000148852.1.58395 WP_000148852.1.58430 WP_000148852.1.58435 WP_000148852.1.58512 WP_000148852.1.58530 WP_000148852.1.5857 WP_000148852.1.58571 WP_000148852.1.58592 WP_000148852.1.58598 WP_000148852.1.58704 WP_000148852.1.58735 WP_000148852.1.58760 WP_000148852.1.58763 WP_000148852.1.58772 WP_000148852.1.5880 WP_000148852.1.58833 WP_000148852.1.58855 WP_000148852.1.58934 WP_000148852.1.58960 WP_000148852.1.58981 WP_000148852.1.59011 WP_000148852.1.59039 WP_000148852.1.59077 WP_000148852.1.59098 WP_000148852.1.59124 WP_000148852.1.59146 WP_000148852.1.59187 WP_000148852.1.5920 WP_000148852.1.59311 WP_000148852.1.59337 WP_000148852.1.59398 WP_000148852.1.5940 WP_000148852.1.59404 WP_000148852.1.59462 WP_000148852.1.59464 WP_000148852.1.59489 WP_000148852.1.59498 WP_000148852.1.59540 WP_000148852.1.59546 WP_000148852.1.59598 WP_000148852.1.59624 WP_000148852.1.59643 WP_000148852.1.59668 WP_000148852.1.59669 WP_000148852.1.59671 WP_000148852.1.5972 WP_000148852.1.59787 WP_000148852.1.5982 WP_000148852.1.59822 WP_000148852.1.59874 WP_000148852.1.59907 WP_000148852.1.59915 WP_000148852.1.60006 WP_000148852.1.6006 WP_000148852.1.6011 WP_000148852.1.60123 WP_000148852.1.60147 WP_000148852.1.60149 WP_000148852.1.60157 WP_000148852.1.6017 WP_000148852.1.60227 WP_000148852.1.60302 WP_000148852.1.60345 WP_000148852.1.60360 WP_000148852.1.60431 WP_000148852.1.60434 WP_000148852.1.60492 WP_000148852.1.60547 WP_000148852.1.60585 WP_000148852.1.60595 WP_000148852.1.60636 WP_000148852.1.60641 WP_000148852.1.60734 WP_000148852.1.60750 WP_000148852.1.60751 WP_000148852.1.60758 WP_000148852.1.60759 WP_000148852.1.60765 WP_000148852.1.60778 WP_000148852.1.60813 WP_000148852.1.60820 WP_000148852.1.60845 WP_000148852.1.6085 WP_000148852.1.60869 WP_000148852.1.60888 WP_000148852.1.60912 WP_000148852.1.60923 WP_000148852.1.60948 WP_000148852.1.61013 WP_000148852.1.61023 WP_000148852.1.61026 WP_000148852.1.61029 WP_000148852.1.61031 WP_000148852.1.61082 WP_000148852.1.61115 WP_000148852.1.61139 WP_000148852.1.61189 WP_000148852.1.6119 WP_000148852.1.6123 WP_000148852.1.61263 WP_000148852.1.61271 WP_000148852.1.61286 WP_000148852.1.61289 WP_000148852.1.61313 WP_000148852.1.61316 WP_000148852.1.61375 WP_000148852.1.61393 WP_000148852.1.61394 WP_000148852.1.61439 WP_000148852.1.61440 WP_000148852.1.61555 WP_000148852.1.61585 WP_000148852.1.61597 WP_000148852.1.61615 WP_000148852.1.61639 WP_000148852.1.6166 WP_000148852.1.61705 WP_000148852.1.61749 WP_000148852.1.61800 WP_000148852.1.61802 WP_000148852.1.61831 WP_000148852.1.61838 WP_000148852.1.619 WP_000148852.1.61903 WP_000148852.1.61936 WP_000148852.1.62002 WP_000148852.1.6201 WP_000148852.1.62028 WP_000148852.1.62069 WP_000148852.1.62071 WP_000148852.1.62096 WP_000148852.1.62247 WP_000148852.1.62254 WP_000148852.1.62346 WP_000148852.1.62352 WP_000148852.1.62382 WP_000148852.1.62398 WP_000148852.1.62429 WP_000148852.1.62453 WP_000148852.1.62474 WP_000148852.1.62496 WP_000148852.1.6250 WP_000148852.1.62553 WP_000148852.1.62602 WP_000148852.1.62625 WP_000148852.1.62630 WP_000148852.1.62653 WP_000148852.1.62671 WP_000148852.1.62674 WP_000148852.1.6268 WP_000148852.1.62684 WP_000148852.1.62723 WP_000148852.1.62764 WP_000148852.1.62771 WP_000148852.1.62822 WP_000148852.1.62824 WP_000148852.1.62831 WP_000148852.1.62863 WP_000148852.1.62880 WP_000148852.1.62970 WP_000148852.1.63003 WP_000148852.1.63027 WP_000148852.1.63052 WP_000148852.1.63070 WP_000148852.1.63083 WP_000148852.1.63139 WP_000148852.1.63140 WP_000148852.1.63220 WP_000148852.1.63266 WP_000148852.1.63289 WP_000148852.1.63304 WP_000148852.1.63313 WP_000148852.1.63333 WP_000148852.1.63341 WP_000148852.1.634 WP_000148852.1.63441 WP_000148852.1.63469 WP_000148852.1.63471 WP_000148852.1.63589 WP_000148852.1.63673 WP_000148852.1.63678 WP_000148852.1.63726 WP_000148852.1.63729 WP_000148852.1.6374 WP_000148852.1.63751 WP_000148852.1.63759 WP_000148852.1.63774 WP_000148852.1.63828 WP_000148852.1.6388 WP_000148852.1.63907 WP_000148852.1.63947 WP_000148852.1.6403 WP_000148852.1.6408 WP_000148852.1.64192 WP_000148852.1.64250 WP_000148852.1.64367 WP_000148852.1.6438 WP_000148852.1.64440 WP_000148852.1.64456 WP_000148852.1.64457 WP_000148852.1.64473 WP_000148852.1.64525 WP_000148852.1.64565 WP_000148852.1.64583 WP_000148852.1.6459 WP_000148852.1.64598 WP_000148852.1.6462 WP_000148852.1.64630 WP_000148852.1.64631 WP_000148852.1.64677 WP_000148852.1.64686 WP_000148852.1.64720 WP_000148852.1.64765 WP_000148852.1.6479 WP_000148852.1.64858 WP_000148852.1.64879 WP_000148852.1.6488 WP_000148852.1.64893 WP_000148852.1.64897 WP_000148852.1.64928 WP_000148852.1.64935 WP_000148852.1.64961 WP_000148852.1.65033 WP_000148852.1.65044 WP_000148852.1.65132 WP_000148852.1.65158 WP_000148852.1.65180 WP_000148852.1.65193 WP_000148852.1.65217 WP_000148852.1.65243 WP_000148852.1.65317 WP_000148852.1.65367 WP_000148852.1.65419 WP_000148852.1.65423 WP_000148852.1.65432 WP_000148852.1.65443 WP_000148852.1.65451 WP_000148852.1.6547 WP_000148852.1.65504 WP_000148852.1.6551 WP_000148852.1.65520 WP_000148852.1.65544 WP_000148852.1.65562 WP_000148852.1.65675 WP_000148852.1.65689 WP_000148852.1.65693 WP_000148852.1.65700 WP_000148852.1.65703 WP_000148852.1.65705 WP_000148852.1.65856 WP_000148852.1.65922 WP_000148852.1.65931 WP_000148852.1.65948 WP_000148852.1.66009 WP_000148852.1.66081 WP_000148852.1.661 WP_000148852.1.66120 WP_000148852.1.66133 WP_000148852.1.66175 WP_000148852.1.66262 WP_000148852.1.66302 WP_000148852.1.66433 WP_000148852.1.66505 WP_000148852.1.66519 WP_000148852.1.66542 WP_000148852.1.66564 WP_000148852.1.66588 WP_000148852.1.66601 WP_000148852.1.66606 WP_000148852.1.6662 WP_000148852.1.66664 WP_000148852.1.66677 WP_000148852.1.66711 WP_000148852.1.6674 WP_000148852.1.66786 WP_000148852.1.6684 WP_000148852.1.66879 WP_000148852.1.67112 WP_000148852.1.67135 WP_000148852.1.67191 WP_000148852.1.6722 WP_000148852.1.67266 WP_000148852.1.67329 WP_000148852.1.67333 WP_000148852.1.67379 WP_000148852.1.6740 WP_000148852.1.67414 WP_000148852.1.67463 WP_000148852.1.67480 WP_000148852.1.67505 WP_000148852.1.67507 WP_000148852.1.67520 WP_000148852.1.67521 WP_000148852.1.67554 WP_000148852.1.67572 WP_000148852.1.67632 WP_000148852.1.67651 WP_000148852.1.67652 WP_000148852.1.67713 WP_000148852.1.67722 WP_000148852.1.67754 WP_000148852.1.67815 WP_000148852.1.6786 WP_000148852.1.67865 WP_000148852.1.67925 WP_000148852.1.67986 WP_000148852.1.68033 WP_000148852.1.68054 WP_000148852.1.68066 WP_000148852.1.6811 WP_000148852.1.68111 WP_000148852.1.68160 WP_000148852.1.68161 WP_000148852.1.68199 WP_000148852.1.68261 WP_000148852.1.68286 WP_000148852.1.68295 WP_000148852.1.68296 WP_000148852.1.6830 WP_000148852.1.68307 WP_000148852.1.6834 WP_000148852.1.68343 WP_000148852.1.68351 WP_000148852.1.68367 WP_000148852.1.6839 WP_000148852.1.68397 WP_000148852.1.68404 WP_000148852.1.68425 WP_000148852.1.68483 WP_000148852.1.68489 WP_000148852.1.68522 WP_000148852.1.68565 WP_000148852.1.68636 WP_000148852.1.68650 WP_000148852.1.68699 WP_000148852.1.68703 WP_000148852.1.68728 WP_000148852.1.68737 WP_000148852.1.68775 WP_000148852.1.68813 WP_000148852.1.68831 WP_000148852.1.68864 WP_000148852.1.68875 WP_000148852.1.68943 WP_000148852.1.68944 WP_000148852.1.69045 WP_000148852.1.69087 WP_000148852.1.69089 WP_000148852.1.691 WP_000148852.1.69147 WP_000148852.1.6917 WP_000148852.1.69191 WP_000148852.1.69219 WP_000148852.1.69222 WP_000148852.1.69237 WP_000148852.1.69366 WP_000148852.1.69395 WP_000148852.1.69415 WP_000148852.1.69476 WP_000148852.1.69480 WP_000148852.1.695 WP_000148852.1.6953 WP_000148852.1.69552 WP_000148852.1.69563 WP_000148852.1.69622 WP_000148852.1.69679 WP_000148852.1.69877 WP_000148852.1.69878 WP_000148852.1.69921 WP_000148852.1.69987 WP_000148852.1.70024 WP_000148852.1.70048 WP_000148852.1.70089 WP_000148852.1.70105 WP_000148852.1.7012 WP_000148852.1.70133 WP_000148852.1.70210 WP_000148852.1.7024 WP_000148852.1.70253 WP_000148852.1.70273 WP_000148852.1.703 WP_000148852.1.7034 WP_000148852.1.70344 WP_000148852.1.70349 WP_000148852.1.7043 WP_000148852.1.70451 WP_000148852.1.70459 WP_000148852.1.70462 WP_000148852.1.7053 WP_000148852.1.70546 WP_000148852.1.7061 WP_000148852.1.70635 WP_000148852.1.70641 WP_000148852.1.7067 WP_000148852.1.7073 WP_000148852.1.70818 WP_000148852.1.70823 WP_000148852.1.70855 WP_000148852.1.70924 WP_000148852.1.70930 WP_000148852.1.70943 WP_000148852.1.71043 WP_000148852.1.71058 WP_000148852.1.71059 WP_000148852.1.71073 WP_000148852.1.7109 WP_000148852.1.71130 WP_000148852.1.71196 WP_000148852.1.7120 WP_000148852.1.7125 WP_000148852.1.71257 WP_000148852.1.71295 WP_000148852.1.71298 WP_000148852.1.71325 WP_000148852.1.71345 WP_000148852.1.71359 WP_000148852.1.71419 WP_000148852.1.71463 WP_000148852.1.7150 WP_000148852.1.71519 WP_000148852.1.71529 WP_000148852.1.71543 WP_000148852.1.71596 WP_000148852.1.71602 WP_000148852.1.7161 WP_000148852.1.71662 WP_000148852.1.71676 WP_000148852.1.71735 WP_000148852.1.71780 WP_000148852.1.7179 WP_000148852.1.71861 WP_000148852.1.71925 WP_000148852.1.71989 WP_000148852.1.72026 WP_000148852.1.72031 WP_000148852.1.72067 WP_000148852.1.72169 WP_000148852.1.72176 WP_000148852.1.72205 WP_000148852.1.72271 WP_000148852.1.72330 WP_000148852.1.72347 WP_000148852.1.7236 WP_000148852.1.72366 WP_000148852.1.72424 WP_000148852.1.72547 WP_000148852.1.72626 WP_000148852.1.72654 WP_000148852.1.72750 WP_000148852.1.72787 WP_000148852.1.72832 WP_000148852.1.72834 WP_000148852.1.72835 WP_000148852.1.72903 WP_000148852.1.72904 WP_000148852.1.72935 WP_000148852.1.72945 WP_000148852.1.73017 WP_000148852.1.73019 WP_000148852.1.73022 WP_000148852.1.73037 WP_000148852.1.73122 WP_000148852.1.73132 WP_000148852.1.73246 WP_000148852.1.73265 WP_000148852.1.73286 WP_000148852.1.73386 WP_000148852.1.73456 WP_000148852.1.73501 WP_000148852.1.73571 WP_000148852.1.73591 WP_000148852.1.736 WP_000148852.1.73639 WP_000148852.1.73685 WP_000148852.1.73735 WP_000148852.1.73759 WP_000148852.1.73786 WP_000148852.1.7380 WP_000148852.1.73834 WP_000148852.1.73858 WP_000148852.1.73868 WP_000148852.1.73920 WP_000148852.1.73961 WP_000148852.1.73969 WP_000148852.1.73976 WP_000148852.1.73983 WP_000148852.1.74006 WP_000148852.1.74010 WP_000148852.1.74027 WP_000148852.1.74081 WP_000148852.1.74157 WP_000148852.1.74161 WP_000148852.1.74172 WP_000148852.1.74173 WP_000148852.1.74183 WP_000148852.1.74216 WP_000148852.1.74234 WP_000148852.1.74237 WP_000148852.1.7427 WP_000148852.1.7434 WP_000148852.1.74353 WP_000148852.1.74356 WP_000148852.1.74380 WP_000148852.1.74429 WP_000148852.1.74457 WP_000148852.1.74533 WP_000148852.1.7457 WP_000148852.1.74587 WP_000148852.1.74610 WP_000148852.1.74638 WP_000148852.1.74696 WP_000148852.1.74704 WP_000148852.1.74731 WP_000148852.1.74747 WP_000148852.1.74802 WP_000148852.1.74866 WP_000148852.1.74890 WP_000148852.1.74911 WP_000148852.1.74922 WP_000148852.1.74924 WP_000148852.1.74961 WP_000148852.1.74994 WP_000148852.1.74999 WP_000148852.1.75038 WP_000148852.1.75044 WP_000148852.1.75048 WP_000148852.1.75052 WP_000148852.1.75093 WP_000148852.1.75141 WP_000148852.1.75186 WP_000148852.1.75227 WP_000148852.1.75252 WP_000148852.1.75253 WP_000148852.1.75294 WP_000148852.1.75298 WP_000148852.1.75320 WP_000148852.1.75327 WP_000148852.1.75349 WP_000148852.1.75365 WP_000148852.1.75399 WP_000148852.1.7542 WP_000148852.1.75438 WP_000148852.1.75440 WP_000148852.1.75527 WP_000148852.1.75551 WP_000148852.1.7561 WP_000148852.1.75649 WP_000148852.1.75652 WP_000148852.1.75685 WP_000148852.1.75769 WP_000148852.1.75775 WP_000148852.1.758 WP_000148852.1.75830 WP_000148852.1.75848 WP_000148852.1.75881 WP_000148852.1.75885 WP_000148852.1.75929 WP_000148852.1.75952 WP_000148852.1.7596 WP_000148852.1.75969 WP_000148852.1.76010 WP_000148852.1.76015 WP_000148852.1.76095 WP_000148852.1.76143 WP_000148852.1.76230 WP_000148852.1.76234 WP_000148852.1.7624 WP_000148852.1.7625 WP_000148852.1.76258 WP_000148852.1.76261 WP_000148852.1.76282 WP_000148852.1.76283 WP_000148852.1.76332 WP_000148852.1.76337 WP_000148852.1.76351 WP_000148852.1.76419 WP_000148852.1.76420 WP_000148852.1.76421 WP_000148852.1.765 WP_000148852.1.7658 WP_000148852.1.76606 WP_000148852.1.76624 WP_000148852.1.76648 WP_000148852.1.76686 WP_000148852.1.76690 WP_000148852.1.76693 WP_000148852.1.76790 WP_000148852.1.76792 WP_000148852.1.768 WP_000148852.1.76816 WP_000148852.1.76839 WP_000148852.1.76845 WP_000148852.1.76897 WP_000148852.1.76921 WP_000148852.1.76944 WP_000148852.1.76952 WP_000148852.1.76998 WP_000148852.1.77031 WP_000148852.1.77041 WP_000148852.1.77050 WP_000148852.1.77060 WP_000148852.1.77062 WP_000148852.1.77112 WP_000148852.1.77145 WP_000148852.1.77305 WP_000148852.1.77426 WP_000148852.1.7745 WP_000148852.1.7746 WP_000148852.1.77489 WP_000148852.1.77497 WP_000148852.1.7752 WP_000148852.1.77520 WP_000148852.1.77527 WP_000148852.1.77533 WP_000148852.1.77536 WP_000148852.1.77572 WP_000148852.1.77603 WP_000148852.1.77606 WP_000148852.1.77738 WP_000148852.1.77743 WP_000148852.1.77818 WP_000148852.1.77822 WP_000148852.1.77848 WP_000148852.1.77858 WP_000148852.1.7787 WP_000148852.1.77952 WP_000148852.1.77957 WP_000148852.1.78054 WP_000148852.1.78091 WP_000148852.1.78095 WP_000148852.1.7810 WP_000148852.1.78173 WP_000148852.1.78189 WP_000148852.1.78207 WP_000148852.1.78208 WP_000148852.1.78252 WP_000148852.1.78254 WP_000148852.1.78257 WP_000148852.1.7827 WP_000148852.1.78311 WP_000148852.1.78332 WP_000148852.1.78365 WP_000148852.1.78404 WP_000148852.1.7850 WP_000148852.1.78558 WP_000148852.1.7857 WP_000148852.1.78604 WP_000148852.1.78653 WP_000148852.1.78667 WP_000148852.1.78728 WP_000148852.1.78803 WP_000148852.1.78819 WP_000148852.1.78841 WP_000148852.1.78897 WP_000148852.1.78983 WP_000148852.1.78985 WP_000148852.1.7900 WP_000148852.1.79006 WP_000148852.1.79038 WP_000148852.1.79051 WP_000148852.1.79085 WP_000148852.1.79131 WP_000148852.1.79170 WP_000148852.1.79197 WP_000148852.1.79208 WP_000148852.1.79223 WP_000148852.1.79227 WP_000148852.1.7931 WP_000148852.1.79310 WP_000148852.1.79314 WP_000148852.1.79322 WP_000148852.1.79332 WP_000148852.1.79367 WP_000148852.1.79374 WP_000148852.1.79408 WP_000148852.1.79436 WP_000148852.1.79461 WP_000148852.1.79476 WP_000148852.1.79487 WP_000148852.1.79539 WP_000148852.1.79556 WP_000148852.1.79626 WP_000148852.1.79662 WP_000148852.1.79672 WP_000148852.1.79676 WP_000148852.1.79706 WP_000148852.1.79822 WP_000148852.1.79831 WP_000148852.1.79834 WP_000148852.1.79837 WP_000148852.1.7989 WP_000148852.1.79896 WP_000148852.1.79911 WP_000148852.1.7992 WP_000148852.1.79941 WP_000148852.1.79961 WP_000148852.1.79971 WP_000148852.1.79991 WP_000148852.1.80000 WP_000148852.1.80032 WP_000148852.1.80042 WP_000148852.1.80079 WP_000148852.1.80109 WP_000148852.1.80127 WP_000148852.1.80287 WP_000148852.1.80290 WP_000148852.1.8031 WP_000148852.1.8035 WP_000148852.1.80358 WP_000148852.1.80378 WP_000148852.1.8043 WP_000148852.1.80472 WP_000148852.1.80530 WP_000148852.1.8065 WP_000148852.1.80653 WP_000148852.1.80687 WP_000148852.1.80717 WP_000148852.1.80761 WP_000148852.1.80763 WP_000148852.1.80781 WP_000148852.1.80786 WP_000148852.1.80833 WP_000148852.1.8084 WP_000148852.1.80872 WP_000148852.1.80962 WP_000148852.1.81085 WP_000148852.1.81114 WP_000148852.1.81157 WP_000148852.1.81171 WP_000148852.1.81234 WP_000148852.1.8125 WP_000148852.1.81252 WP_000148852.1.81344 WP_000148852.1.8135 WP_000148852.1.81385 WP_000148852.1.81389 WP_000148852.1.8142 WP_000148852.1.81464 WP_000148852.1.81467 WP_000148852.1.81599 WP_000148852.1.81610 WP_000148852.1.81718 WP_000148852.1.81740 WP_000148852.1.81758 WP_000148852.1.81800 WP_000148852.1.81810 WP_000148852.1.81812 WP_000148852.1.81831 WP_000148852.1.81870 WP_000148852.1.81897 WP_000148852.1.81903 WP_000148852.1.81905 WP_000148852.1.81906 WP_000148852.1.81919 WP_000148852.1.81944 WP_000148852.1.81955 WP_000148852.1.81999 WP_000148852.1.82009 WP_000148852.1.82053 WP_000148852.1.8212 WP_000148852.1.82121 WP_000148852.1.82219 WP_000148852.1.82247 WP_000148852.1.82259 WP_000148852.1.82278 WP_000148852.1.82340 WP_000148852.1.82354 WP_000148852.1.82358 WP_000148852.1.82368 WP_000148852.1.82447 WP_000148852.1.8246 WP_000148852.1.82467 WP_000148852.1.82548 WP_000148852.1.82612 WP_000148852.1.82709 WP_000148852.1.82724 WP_000148852.1.82796 WP_000148852.1.8280 WP_000148852.1.82802 WP_000148852.1.82862 WP_000148852.1.8289 WP_000148852.1.82976 WP_000148852.1.82980 WP_000148852.1.83152 WP_000148852.1.83153 WP_000148852.1.83185 WP_000148852.1.83193 WP_000148852.1.83234 WP_000148852.1.8328 WP_000148852.1.83316 WP_000148852.1.83352 WP_000148852.1.83372 WP_000148852.1.83418 WP_000148852.1.83476 WP_000148852.1.83484 WP_000148852.1.83508 WP_000148852.1.83517 WP_000148852.1.83593 WP_000148852.1.83646 WP_000148852.1.83653 WP_000148852.1.83676 WP_000148852.1.83720 WP_000148852.1.83763 WP_000148852.1.83769 WP_000148852.1.83770 WP_000148852.1.83775 WP_000148852.1.83804 WP_000148852.1.83825 WP_000148852.1.8383 WP_000148852.1.83864 WP_000148852.1.83865 WP_000148852.1.83881 WP_000148852.1.83905 WP_000148852.1.83912 WP_000148852.1.83919 WP_000148852.1.83928 WP_000148852.1.83955 WP_000148852.1.83984 WP_000148852.1.84049 WP_000148852.1.84064 WP_000148852.1.84163 WP_000148852.1.84293 WP_000148852.1.84342 WP_000148852.1.84442 WP_000148852.1.84445 WP_000148852.1.84451 WP_000148852.1.84508 WP_000148852.1.84509 WP_000148852.1.84563 WP_000148852.1.84578 WP_000148852.1.84625 WP_000148852.1.84638 WP_000148852.1.8468 WP_000148852.1.84682 WP_000148852.1.8475 WP_000148852.1.84752 WP_000148852.1.84757 WP_000148852.1.84761 WP_000148852.1.84815 WP_000148852.1.84889 WP_000148852.1.84903 WP_000148852.1.84907 WP_000148852.1.84922 WP_000148852.1.8493 WP_000148852.1.85022 WP_000148852.1.85047 WP_000148852.1.85056 WP_000148852.1.85081 WP_000148852.1.85099 WP_000148852.1.85132 WP_000148852.1.85135 WP_000148852.1.85144 WP_000148852.1.85213 WP_000148852.1.85226 WP_000148852.1.85235 WP_000148852.1.85238 WP_000148852.1.85302 WP_000148852.1.85351 WP_000148852.1.85383 WP_000148852.1.85395 WP_000148852.1.85404 WP_000148852.1.85445 WP_000148852.1.85462 WP_000148852.1.85471 WP_000148852.1.85474 WP_000148852.1.85492 WP_000148852.1.85506 WP_000148852.1.85515 WP_000148852.1.85519 WP_000148852.1.85547 WP_000148852.1.85586 WP_000148852.1.85596 WP_000148852.1.85649 WP_000148852.1.85758 WP_000148852.1.85795 WP_000148852.1.85796 WP_000148852.1.85816 WP_000148852.1.85834 WP_000148852.1.85873 WP_000148852.1.85927 WP_000148852.1.85950 WP_000148852.1.85989 WP_000148852.1.85993 WP_000148852.1.86018 WP_000148852.1.86072 WP_000148852.1.86123 WP_000148852.1.86144 WP_000148852.1.86154 WP_000148852.1.86158 WP_000148852.1.8617 WP_000148852.1.86188 WP_000148852.1.86207 WP_000148852.1.86248 WP_000148852.1.8627 WP_000148852.1.86270 WP_000148852.1.86304 WP_000148852.1.86344 WP_000148852.1.86367 WP_000148852.1.86378 WP_000148852.1.8643 WP_000148852.1.86439 WP_000148852.1.86482 WP_000148852.1.86523 WP_000148852.1.86542 WP_000148852.1.86628 WP_000148852.1.86706 WP_000148852.1.86792 WP_000148852.1.8681 WP_000148852.1.86838 WP_000148852.1.86911 WP_000148852.1.86940 WP_000148852.1.86942 WP_000148852.1.86961 WP_000148852.1.87021 WP_000148852.1.87042 WP_000148852.1.87057 WP_000148852.1.87072 WP_000148852.1.87090 WP_000148852.1.87119 WP_000148852.1.8712 WP_000148852.1.87122 WP_000148852.1.87141 WP_000148852.1.87175 WP_000148852.1.87194 WP_000148852.1.8720 WP_000148852.1.87260 WP_000148852.1.87261 WP_000148852.1.87285 WP_000148852.1.87290 WP_000148852.1.8731 WP_000148852.1.87396 WP_000148852.1.87457 WP_000148852.1.87461 WP_000148852.1.87466 WP_000148852.1.875 WP_000148852.1.87508 WP_000148852.1.87515 WP_000148852.1.8753 WP_000148852.1.87543 WP_000148852.1.87710 WP_000148852.1.87718 WP_000148852.1.87748 WP_000148852.1.87764 WP_000148852.1.8779 WP_000148852.1.87808 WP_000148852.1.87828 WP_000148852.1.87838 WP_000148852.1.87879 WP_000148852.1.8791 WP_000148852.1.87912 WP_000148852.1.87963 WP_000148852.1.87964 WP_000148852.1.87972 WP_000148852.1.87995 WP_000148852.1.88013 WP_000148852.1.88032 WP_000148852.1.88061 WP_000148852.1.88114 WP_000148852.1.88150 WP_000148852.1.88270 WP_000148852.1.88317 WP_000148852.1.88319 WP_000148852.1.88351 WP_000148852.1.88367 WP_000148852.1.88371 WP_000148852.1.88373 WP_000148852.1.88380 WP_000148852.1.88480 WP_000148852.1.88498 WP_000148852.1.88518 WP_000148852.1.88555 WP_000148852.1.88558 WP_000148852.1.8857 WP_000148852.1.88580 WP_000148852.1.88599 WP_000148852.1.88623 WP_000148852.1.88636 WP_000148852.1.88642 WP_000148852.1.88671 WP_000148852.1.88694 WP_000148852.1.8872 WP_000148852.1.88739 WP_000148852.1.88856 WP_000148852.1.88859 WP_000148852.1.8886 WP_000148852.1.8888 WP_000148852.1.88897 WP_000148852.1.88922 WP_000148852.1.88934 WP_000148852.1.8899 WP_000148852.1.8900 WP_000148852.1.89086 WP_000148852.1.8913 WP_000148852.1.89181 WP_000148852.1.89194 WP_000148852.1.89195 WP_000148852.1.89204 WP_000148852.1.8924 WP_000148852.1.89258 WP_000148852.1.89284 WP_000148852.1.89516 WP_000148852.1.89537 WP_000148852.1.89544 WP_000148852.1.89545 WP_000148852.1.89559 WP_000148852.1.89655 WP_000148852.1.89672 WP_000148852.1.89678 WP_000148852.1.897 WP_000148852.1.89726 WP_000148852.1.89730 WP_000148852.1.89754 WP_000148852.1.89857 WP_000148852.1.89883 WP_000148852.1.89935 WP_000148852.1.89960 WP_000148852.1.90005 WP_000148852.1.90018 WP_000148852.1.90038 WP_000148852.1.90046 WP_000148852.1.90055 WP_000148852.1.90091 WP_000148852.1.90131 WP_000148852.1.90148 WP_000148852.1.90161 WP_000148852.1.90180 WP_000148852.1.90215 WP_000148852.1.9022 WP_000148852.1.90243 WP_000148852.1.90253 WP_000148852.1.90276 WP_000148852.1.9030 WP_000148852.1.90331 WP_000148852.1.90367 WP_000148852.1.90473 WP_000148852.1.90544 WP_000148852.1.90554 WP_000148852.1.90604 WP_000148852.1.90647 WP_000148852.1.90660 WP_000148852.1.90683 WP_000148852.1.90728 WP_000148852.1.90738 WP_000148852.1.90745 WP_000148852.1.90801 WP_000148852.1.90804 WP_000148852.1.90861 WP_000148852.1.90896 WP_000148852.1.90903 WP_000148852.1.9100 WP_000148852.1.91011 WP_000148852.1.91124 WP_000148852.1.91126 WP_000148852.1.9114 WP_000148852.1.91158 WP_000148852.1.91177 WP_000148852.1.912 WP_000148852.1.91233 WP_000148852.1.91246 WP_000148852.1.91258 WP_000148852.1.91279 WP_000148852.1.91332 WP_000148852.1.91346 WP_000148852.1.91357 WP_000148852.1.91364 WP_000148852.1.91382 WP_000148852.1.9140 WP_000148852.1.91420 WP_000148852.1.91427 WP_000148852.1.91487 WP_000148852.1.91500 WP_000148852.1.91559 WP_000148852.1.91573 WP_000148852.1.91581 WP_000148852.1.91587 WP_000148852.1.91639 WP_000148852.1.91749 WP_000148852.1.91771 WP_000148852.1.91791 WP_000148852.1.91800 WP_000148852.1.91816 WP_000148852.1.91829 WP_000148852.1.91895 WP_000148852.1.91928 WP_000148852.1.91950 WP_000148852.1.92 WP_000148852.1.92133 WP_000148852.1.92140 WP_000148852.1.92143 WP_000148852.1.92164 WP_000148852.1.92169 WP_000148852.1.92173 WP_000148852.1.92185 WP_000148852.1.92196 WP_000148852.1.92227 WP_000148852.1.9224 WP_000148852.1.92253 WP_000148852.1.92254 WP_000148852.1.92297 WP_000148852.1.923 WP_000148852.1.9234 WP_000148852.1.9239 WP_000148852.1.92415 WP_000148852.1.92436 WP_000148852.1.92442 WP_000148852.1.92488 WP_000148852.1.92497 WP_000148852.1.92500 WP_000148852.1.92520 WP_000148852.1.92534 WP_000148852.1.92541 WP_000148852.1.92565 WP_000148852.1.92607 WP_000148852.1.92679 WP_000148852.1.92691 WP_000148852.1.92723 WP_000148852.1.92735 WP_000148852.1.92741 WP_000148852.1.92773 WP_000148852.1.92789 WP_000148852.1.92805 WP_000148852.1.92862 WP_000148852.1.92864 WP_000148852.1.9293 WP_000148852.1.92950 WP_000148852.1.9305 WP_000148852.1.93074 WP_000148852.1.93125 WP_000148852.1.93163 WP_000148852.1.93176 WP_000148852.1.93191 WP_000148852.1.93211 WP_000148852.1.93224 WP_000148852.1.93296 WP_000148852.1.93300 WP_000148852.1.93336 WP_000148852.1.93416 WP_000148852.1.93438 WP_000148852.1.93444 WP_000148852.1.93514 WP_000148852.1.9352 WP_000148852.1.9354 WP_000148852.1.9358 WP_000148852.1.93590 WP_000148852.1.93658 WP_000148852.1.93678 WP_000148852.1.93710 WP_000148852.1.93722 WP_000148852.1.93738 WP_000148852.1.93769 WP_000148852.1.93787 WP_000148852.1.9387 WP_000148852.1.93882 WP_000148852.1.93883 WP_000148852.1.93891 WP_000148852.1.93976 WP_000148852.1.9398 WP_000148852.1.93981 WP_000148852.1.94074 WP_000148852.1.94082 WP_000148852.1.94087 WP_000148852.1.94096 WP_000148852.1.9411 WP_000148852.1.94119 WP_000148852.1.94165 WP_000148852.1.94172 WP_000148852.1.94293 WP_000148852.1.94294 WP_000148852.1.94335 WP_000148852.1.94340 WP_000148852.1.94374 WP_000148852.1.94375 WP_000148852.1.94376 WP_000148852.1.94389 WP_000148852.1.94414 WP_000148852.1.94530 WP_000148852.1.94550 WP_000148852.1.94576 WP_000148852.1.9464 WP_000148852.1.94688 WP_000148852.1.94733 WP_000148852.1.94741 WP_000148852.1.94797 WP_000148852.1.94844 WP_000148852.1.94845 WP_000148852.1.9485 WP_000148852.1.94857 WP_000148852.1.94866 WP_000148852.1.9497 WP_000148852.1.94980 WP_000148852.1.94989 WP_000148852.1.94999 WP_000148852.1.95038 WP_000148852.1.95075 WP_000148852.1.95077 WP_000148852.1.9510 WP_000148852.1.95120 WP_000148852.1.95210 WP_000148852.1.95318 WP_000148852.1.95327 WP_000148852.1.95342 WP_000148852.1.95361 WP_000148852.1.95372 WP_000148852.1.9538 WP_000148852.1.95476 WP_000148852.1.95537 WP_000148852.1.95550 WP_000148852.1.95571 WP_000148852.1.95581 WP_000148852.1.95603 WP_000148852.1.95639 WP_000148852.1.95681 WP_000148852.1.95699 WP_000148852.1.95704 WP_000148852.1.95714 WP_000148852.1.95737 WP_000148852.1.95760 WP_000148852.1.95806 WP_000148852.1.95877 WP_000148852.1.95885 WP_000148852.1.95914 WP_000148852.1.95918 WP_000148852.1.95986 WP_000148852.1.95997 WP_000148852.1.96014 WP_000148852.1.96022 WP_000148852.1.96030 WP_000148852.1.96057 WP_000148852.1.96067 WP_000148852.1.96075 WP_000148852.1.96135 WP_000148852.1.96148 WP_000148852.1.96165 WP_000148852.1.9617 WP_000148852.1.96228 WP_000148852.1.96255 WP_000148852.1.96283 WP_000148852.1.96297 WP_000148852.1.96312 WP_000148852.1.96314 WP_000148852.1.96322 WP_000148852.1.96334 WP_000148852.1.96362 WP_000148852.1.96433 WP_000148852.1.96472 WP_000148852.1.96474 WP_000148852.1.9650 WP_000148852.1.96535 WP_000148852.1.96538 WP_000148852.1.96554 WP_000148852.1.96566 WP_000148852.1.96591 WP_000148852.1.96603 WP_000148852.1.96634 WP_000148852.1.96654 WP_000148852.1.96678 WP_000148852.1.96705 WP_000148852.1.9675 WP_000148852.1.96780 WP_000148852.1.96836 WP_000148852.1.96854 WP_000148852.1.96855 WP_000148852.1.96859 WP_000148852.1.96922 WP_000148852.1.96965 WP_000148852.1.96969 WP_000148852.1.96985 WP_000148852.1.96997 WP_000148852.1.97000 WP_000148852.1.97004 WP_000148852.1.97014 WP_000148852.1.97017 WP_000148852.1.97029 WP_000148852.1.97034 WP_000148852.1.97141 WP_000148852.1.97161 WP_000148852.1.97164 WP_000148852.1.97205 WP_000148852.1.97228 WP_000148852.1.97230 WP_000148852.1.97241 WP_000148852.1.97312 WP_000148852.1.97336 WP_000148852.1.97348 WP_000148852.1.97352 WP_000148852.1.97355 WP_000148852.1.97367 WP_000148852.1.9737 WP_000148852.1.97392 WP_000148852.1.97427 WP_000148852.1.9743 WP_000148852.1.97450 WP_000148852.1.97456 WP_000148852.1.97468 WP_000148852.1.97494 WP_000148852.1.97530 WP_000148852.1.97531 WP_000148852.1.97537 WP_000148852.1.97576 WP_000148852.1.97585 WP_000148852.1.97664 WP_000148852.1.97687 WP_000148852.1.97696 WP_000148852.1.97699 WP_000148852.1.97720 WP_000148852.1.97729 WP_000148852.1.97744 WP_000148852.1.97746 WP_000148852.1.97762 WP_000148852.1.9788 WP_000148852.1.97935 WP_000148852.1.97955 WP_000148852.1.97967 WP_000148852.1.97974 WP_000148852.1.97997 WP_000148852.1.98054 WP_000148852.1.98058 WP_000148852.1.98073 WP_000148852.1.98161 WP_000148852.1.98174 WP_000148852.1.98179 WP_000148852.1.98195 WP_000148852.1.98233 WP_000148852.1.98248 WP_000148852.1.98249 WP_000148852.1.98281 WP_000148852.1.98295 WP_000148852.1.98328 WP_000148852.1.98352 WP_000148852.1.98353 WP_000148852.1.98366 WP_000148852.1.98409 WP_000148852.1.98425 WP_000148852.1.98585 WP_000148852.1.98609 WP_000148852.1.98659 WP_000148852.1.98667 WP_000148852.1.9872 WP_000148852.1.98723 WP_000148852.1.98730 WP_000148852.1.98734 WP_000148852.1.98741 WP_000148852.1.98750 WP_000148852.1.98786 WP_000148852.1.98797 WP_000148852.1.98821 WP_000148852.1.98842 WP_000148852.1.98880 WP_000148852.1.98883 WP_000148852.1.98894 WP_000148852.1.98978 WP_000148852.1.98985 WP_000148852.1.9910 WP_000148852.1.9912 WP_000148852.1.99136 WP_000148852.1.99207 WP_000148852.1.99217 WP_000148852.1.99283 WP_000148852.1.99308 WP_000148852.1.99414 WP_000148852.1.99418 WP_000148852.1.99509 WP_000148852.1.99523 WP_000148852.1.9965 WP_000148852.1.99683 WP_000148852.1.99830 WP_000148852.1.99849 WP_000148852.1.99859 WP_000148852.1.99884 WP_000148852.1.99954 WP_000148852.1.99955 WP_000148852.1.99984 WP_000148852.1.99999 gi|15926551|ref|NP_374084.1| jgi|Aspzo1|143403|fgenesh1_pg.9_#_462 gi|470194899|ref|YP_007581251.1| gi|15923952|ref|NP_371486.1| gi|156979288|ref|YP_001441547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]