SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470191841|ref|YP_007578151.1| from Staphylococcus aureus ST228/10388

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470191841|ref|YP_007578151.1|
Domain Number 1 Region: 251-607
Classification Level Classification E-value
Superfamily SIS domain 2.97e-92
Family double-SIS domain 0.00000068
Further Details:      
 
Domain Number 2 Region: 8-241
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.77e-68
Family Class II glutamine amidotransferases 0.00000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470191841|ref|YP_007578151.1|
Sequence length 607
Comment Glucosamine--fructose-6-phosphate aminotransferas e [Staphylococcus aureus subsp. aureus ST228]
Sequence
MEENVVMCGIVGYIGYDNAKELLLKGLEKLEYRGYDSAGIAVVNDDNTTVFKEKGRIAEL
RKVADSSDFDGPVGIGHTRWATHGVPNHENSHPHQSSNGRFTLVHNGVIENYEELKGEYL
QGVSFISETDTEVIVQLVEYFSNQGLSTEEAFTKVVSLLHGSYALGLLDAEDKDTIYVAK
NKSPLLLGVGEGFNVIASDALAMLQVTSEYKEIHDHEIVIVKKDEVIIKDADGNVVERDS
YIAEIDASDAEKGVYAHYMLKEIHEQPAVMRRIIQEYQDAEGNLKIDQDIINDVKEADRI
YVIAAGTSYHAGLVGKEFLEKWAGVPTEVHVASEFVYNMPLLSEKPLFVYISQSGETADS
RAVLVETNKLGHKSLTITNVAGSTLSREADHTLLLHAGPEIAVASTKAYTAQIAVLSILS
QIVAKEHGREADIDLLRELAKVTTAIEVIVDDAPIMEQIATDFLETTRNAFFIGRTIDYN
VSLEGALKLKEISYIQAEGFAGGELKHGTIALIEDGTPVVALATQENVNLSIRGNVKEVV
ARGAHPCIISMEGLEKEGDTYVIPHVHELLTPLVSVVALQLISYYAALHRDLDVDKPRNL
AKSVTVE
Download sequence
Identical sequences gi|470225262|ref|YP_007623841.1| gi|470195772|ref|YP_007582124.1| gi|470219473|ref|YP_007619867.1| gi|470191841|ref|YP_007578151.1| gi|470223295|ref|YP_007621852.1| gi|470193806|ref|YP_007580159.1| gi|470197737|ref|YP_007584138.1| gi|470199706|ref|YP_007586106.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]