SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470191952|ref|YP_007578262.1| from Staphylococcus aureus ST228/10388

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470191952|ref|YP_007578262.1|
Domain Number 1 Region: 101-280
Classification Level Classification E-value
Superfamily SIS domain 9.34e-31
Family mono-SIS domain 0.0055
Further Details:      
 
Domain Number 2 Region: 2-75
Classification Level Classification E-value
Superfamily Homeodomain-like 9.14e-17
Family RpiR-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470191952|ref|YP_007578262.1|
Sequence length 290
Comment Phosphosugar-binding transcriptional regulator RpiR family protein [Staphylococcus aureus subsp. aureus ST228]
Sequence
MSNVLTEIDSQYPYMTKNEKKIAKFILNSPQKVIKMRSQDLASLLDISTSSVIRFSKKIT
DGGFHDLKINISKYVPKASSIYNVELMNNESTESLRTKLHTRTTRALNHANNELNDKTID
QICHCLKRSETIFIYGFGASFVVATDLYQKLSRIGLNIQLVQETHIFATLLATHNSNDSV
ILITNNGTQSEMQSMVKVIDDYHIPIITITSTRDNPVAQASNIVLTYGKTDENEMHMGAT
TSLFAQMFTIDILYYRYVALNYHASLDFITQSKMALDNYRKHLSNINFKH
Download sequence
Identical sequences A0A0D1IR83 A0A0E1AJG8 A0A0E1VN73 A0A0E1XBZ2 A0A0H2WWS0 A0A0H3JNM4 A0A0H3JWX3 A0A0H3JXN3 A0A0H3KA41 A0A1E8XCK2 Q2FVV2 W8U8M3
jgi|Aspzo1|146824|fgenesh1_pg.24_#_67 gi|532360366|ref|YP_008450195.1| gi|470193917|ref|YP_007580270.1| gi|161510510|ref|YP_001576169.1| gi|521213072|ref|YP_008169418.1| gi|269203945|ref|YP_003283214.1| gi|384862957|ref|YP_005745677.1| gi|156980630|ref|YP_001442889.1| WP_000073195.1.100013 WP_000073195.1.100041 WP_000073195.1.100049 WP_000073195.1.100057 WP_000073195.1.10006 WP_000073195.1.100067 WP_000073195.1.100072 WP_000073195.1.100075 WP_000073195.1.100084 WP_000073195.1.100088 WP_000073195.1.100090 WP_000073195.1.100094 WP_000073195.1.100096 WP_000073195.1.100122 WP_000073195.1.10014 WP_000073195.1.100154 WP_000073195.1.100171 WP_000073195.1.100180 WP_000073195.1.100184 WP_000073195.1.100189 WP_000073195.1.100235 WP_000073195.1.100298 WP_000073195.1.100307 WP_000073195.1.100310 WP_000073195.1.10032 WP_000073195.1.100335 WP_000073195.1.100352 WP_000073195.1.100357 WP_000073195.1.100366 WP_000073195.1.100384 WP_000073195.1.100391 WP_000073195.1.100399 WP_000073195.1.10041 WP_000073195.1.10046 WP_000073195.1.100464 WP_000073195.1.10050 WP_000073195.1.100507 WP_000073195.1.100527 WP_000073195.1.100535 WP_000073195.1.100551 WP_000073195.1.100560 WP_000073195.1.100562 WP_000073195.1.100582 WP_000073195.1.100596 WP_000073195.1.100604 WP_000073195.1.100612 WP_000073195.1.100613 WP_000073195.1.100618 WP_000073195.1.100631 WP_000073195.1.100647 WP_000073195.1.100665 WP_000073195.1.100668 WP_000073195.1.100693 WP_000073195.1.100699 WP_000073195.1.100704 WP_000073195.1.100719 WP_000073195.1.100761 WP_000073195.1.100768 WP_000073195.1.100785 WP_000073195.1.100823 WP_000073195.1.100832 WP_000073195.1.100834 WP_000073195.1.10085 WP_000073195.1.100860 WP_000073195.1.100888 WP_000073195.1.1009 WP_000073195.1.100903 WP_000073195.1.100920 WP_000073195.1.100922 WP_000073195.1.100934 WP_000073195.1.100956 WP_000073195.1.10097 WP_000073195.1.100981 WP_000073195.1.100986 WP_000073195.1.100987 WP_000073195.1.101002 WP_000073195.1.101017 WP_000073195.1.101019 WP_000073195.1.101023 WP_000073195.1.101027 WP_000073195.1.101058 WP_000073195.1.101068 WP_000073195.1.101071 WP_000073195.1.101072 WP_000073195.1.101084 WP_000073195.1.101103 WP_000073195.1.10111 WP_000073195.1.101160 WP_000073195.1.101177 WP_000073195.1.101192 WP_000073195.1.101240 WP_000073195.1.101262 WP_000073195.1.101266 WP_000073195.1.101298 WP_000073195.1.101327 WP_000073195.1.101329 WP_000073195.1.101330 WP_000073195.1.101355 WP_000073195.1.101375 WP_000073195.1.101379 WP_000073195.1.101393 WP_000073195.1.101402 WP_000073195.1.101406 WP_000073195.1.101440 WP_000073195.1.101441 WP_000073195.1.101458 WP_000073195.1.101490 WP_000073195.1.1015 WP_000073195.1.101505 WP_000073195.1.101511 WP_000073195.1.101566 WP_000073195.1.101570 WP_000073195.1.101598 WP_000073195.1.101615 WP_000073195.1.101617 WP_000073195.1.101619 WP_000073195.1.101627 WP_000073195.1.101645 WP_000073195.1.10165 WP_000073195.1.101657 WP_000073195.1.10166 WP_000073195.1.101661 WP_000073195.1.101691 WP_000073195.1.101704 WP_000073195.1.101716 WP_000073195.1.101725 WP_000073195.1.101728 WP_000073195.1.101731 WP_000073195.1.101745 WP_000073195.1.101757 WP_000073195.1.101758 WP_000073195.1.101775 WP_000073195.1.101778 WP_000073195.1.101779 WP_000073195.1.101788 WP_000073195.1.101813 WP_000073195.1.101820 WP_000073195.1.101824 WP_000073195.1.101825 WP_000073195.1.101831 WP_000073195.1.101852 WP_000073195.1.101902 WP_000073195.1.101906 WP_000073195.1.101921 WP_000073195.1.101922 WP_000073195.1.101943 WP_000073195.1.101950 WP_000073195.1.102064 WP_000073195.1.102065 WP_000073195.1.102066 WP_000073195.1.102070 WP_000073195.1.102096 WP_000073195.1.102123 WP_000073195.1.102130 WP_000073195.1.102132 WP_000073195.1.10214 WP_000073195.1.1022 WP_000073195.1.10232 WP_000073195.1.10238 WP_000073195.1.10240 WP_000073195.1.10244 WP_000073195.1.10249 WP_000073195.1.1025 WP_000073195.1.10274 WP_000073195.1.10292 WP_000073195.1.10294 WP_000073195.1.10301 WP_000073195.1.10306 WP_000073195.1.1031 WP_000073195.1.1032 WP_000073195.1.10321 WP_000073195.1.10343 WP_000073195.1.10355 WP_000073195.1.10397 WP_000073195.1.10408 WP_000073195.1.1043 WP_000073195.1.10431 WP_000073195.1.10436 WP_000073195.1.10450 WP_000073195.1.10478 WP_000073195.1.10481 WP_000073195.1.10486 WP_000073195.1.10503 WP_000073195.1.1052 WP_000073195.1.10526 WP_000073195.1.10542 WP_000073195.1.10543 WP_000073195.1.10565 WP_000073195.1.10583 WP_000073195.1.10614 WP_000073195.1.10624 WP_000073195.1.10644 WP_000073195.1.10664 WP_000073195.1.10679 WP_000073195.1.10707 WP_000073195.1.10726 WP_000073195.1.10742 WP_000073195.1.10751 WP_000073195.1.1077 WP_000073195.1.10783 WP_000073195.1.10841 WP_000073195.1.10858 WP_000073195.1.1087 WP_000073195.1.10917 WP_000073195.1.10919 WP_000073195.1.10928 WP_000073195.1.10942 WP_000073195.1.10950 WP_000073195.1.10965 WP_000073195.1.10969 WP_000073195.1.1097 WP_000073195.1.10976 WP_000073195.1.10985 WP_000073195.1.10986 WP_000073195.1.11001 WP_000073195.1.11067 WP_000073195.1.11069 WP_000073195.1.11073 WP_000073195.1.11074 WP_000073195.1.11076 WP_000073195.1.11083 WP_000073195.1.11084 WP_000073195.1.11129 WP_000073195.1.1115 WP_000073195.1.11162 WP_000073195.1.11184 WP_000073195.1.1120 WP_000073195.1.11202 WP_000073195.1.11220 WP_000073195.1.11228 WP_000073195.1.11234 WP_000073195.1.11261 WP_000073195.1.11282 WP_000073195.1.11286 WP_000073195.1.11287 WP_000073195.1.11294 WP_000073195.1.11322 WP_000073195.1.11333 WP_000073195.1.11348 WP_000073195.1.11353 WP_000073195.1.1136 WP_000073195.1.11365 WP_000073195.1.11377 WP_000073195.1.11378 WP_000073195.1.11391 WP_000073195.1.11403 WP_000073195.1.11407 WP_000073195.1.11434 WP_000073195.1.11441 WP_000073195.1.11447 WP_000073195.1.11451 WP_000073195.1.11463 WP_000073195.1.1147 WP_000073195.1.11488 WP_000073195.1.11492 WP_000073195.1.11494 WP_000073195.1.11504 WP_000073195.1.1151 WP_000073195.1.11513 WP_000073195.1.1152 WP_000073195.1.11525 WP_000073195.1.11540 WP_000073195.1.11556 WP_000073195.1.11558 WP_000073195.1.11571 WP_000073195.1.11580 WP_000073195.1.11592 WP_000073195.1.11611 WP_000073195.1.11640 WP_000073195.1.11646 WP_000073195.1.11655 WP_000073195.1.11663 WP_000073195.1.11692 WP_000073195.1.117 WP_000073195.1.1171 WP_000073195.1.11719 WP_000073195.1.11720 WP_000073195.1.11723 WP_000073195.1.11736 WP_000073195.1.11768 WP_000073195.1.11794 WP_000073195.1.11795 WP_000073195.1.11816 WP_000073195.1.11829 WP_000073195.1.11837 WP_000073195.1.11884 WP_000073195.1.11894 WP_000073195.1.11903 WP_000073195.1.11904 WP_000073195.1.11969 WP_000073195.1.11991 WP_000073195.1.12005 WP_000073195.1.12019 WP_000073195.1.12026 WP_000073195.1.12029 WP_000073195.1.12042 WP_000073195.1.1205 WP_000073195.1.12073 WP_000073195.1.12098 WP_000073195.1.1210 WP_000073195.1.12123 WP_000073195.1.1213 WP_000073195.1.12149 WP_000073195.1.12152 WP_000073195.1.12158 WP_000073195.1.12170 WP_000073195.1.12175 WP_000073195.1.12179 WP_000073195.1.12181 WP_000073195.1.12193 WP_000073195.1.12194 WP_000073195.1.12201 WP_000073195.1.12226 WP_000073195.1.12233 WP_000073195.1.12234 WP_000073195.1.12256 WP_000073195.1.12272 WP_000073195.1.12297 WP_000073195.1.12328 WP_000073195.1.12330 WP_000073195.1.12361 WP_000073195.1.12366 WP_000073195.1.12391 WP_000073195.1.12436 WP_000073195.1.12437 WP_000073195.1.12447 WP_000073195.1.12498 WP_000073195.1.12508 WP_000073195.1.12516 WP_000073195.1.1252 WP_000073195.1.1253 WP_000073195.1.12555 WP_000073195.1.1257 WP_000073195.1.12597 WP_000073195.1.12598 WP_000073195.1.12608 WP_000073195.1.12618 WP_000073195.1.12639 WP_000073195.1.12668 WP_000073195.1.12685 WP_000073195.1.12711 WP_000073195.1.12715 WP_000073195.1.12733 WP_000073195.1.12737 WP_000073195.1.1276 WP_000073195.1.12770 WP_000073195.1.12771 WP_000073195.1.12772 WP_000073195.1.12780 WP_000073195.1.12788 WP_000073195.1.12822 WP_000073195.1.12829 WP_000073195.1.12833 WP_000073195.1.12845 WP_000073195.1.12858 WP_000073195.1.12862 WP_000073195.1.12884 WP_000073195.1.12886 WP_000073195.1.12903 WP_000073195.1.12904 WP_000073195.1.12918 WP_000073195.1.12920 WP_000073195.1.12937 WP_000073195.1.12938 WP_000073195.1.12977 WP_000073195.1.13013 WP_000073195.1.13039 WP_000073195.1.13062 WP_000073195.1.13072 WP_000073195.1.13091 WP_000073195.1.13104 WP_000073195.1.13154 WP_000073195.1.13164 WP_000073195.1.13169 WP_000073195.1.13189 WP_000073195.1.13228 WP_000073195.1.13243 WP_000073195.1.13250 WP_000073195.1.13303 WP_000073195.1.13307 WP_000073195.1.13317 WP_000073195.1.13322 WP_000073195.1.13326 WP_000073195.1.13336 WP_000073195.1.13355 WP_000073195.1.13379 WP_000073195.1.13381 WP_000073195.1.13405 WP_000073195.1.13448 WP_000073195.1.13468 WP_000073195.1.1347 WP_000073195.1.13486 WP_000073195.1.13501 WP_000073195.1.13505 WP_000073195.1.13514 WP_000073195.1.13531 WP_000073195.1.13532 WP_000073195.1.1355 WP_000073195.1.13554 WP_000073195.1.13556 WP_000073195.1.13557 WP_000073195.1.13568 WP_000073195.1.13598 WP_000073195.1.13612 WP_000073195.1.13617 WP_000073195.1.13650 WP_000073195.1.13654 WP_000073195.1.13665 WP_000073195.1.13668 WP_000073195.1.13670 WP_000073195.1.13679 WP_000073195.1.13680 WP_000073195.1.13683 WP_000073195.1.13696 WP_000073195.1.13709 WP_000073195.1.13726 WP_000073195.1.13727 WP_000073195.1.13733 WP_000073195.1.13734 WP_000073195.1.1374 WP_000073195.1.13755 WP_000073195.1.13757 WP_000073195.1.13772 WP_000073195.1.13787 WP_000073195.1.13804 WP_000073195.1.13805 WP_000073195.1.13807 WP_000073195.1.13831 WP_000073195.1.13879 WP_000073195.1.13897 WP_000073195.1.13904 WP_000073195.1.13933 WP_000073195.1.13940 WP_000073195.1.13947 WP_000073195.1.13983 WP_000073195.1.13986 WP_000073195.1.13987 WP_000073195.1.14010 WP_000073195.1.14025 WP_000073195.1.14034 WP_000073195.1.14071 WP_000073195.1.14076 WP_000073195.1.14097 WP_000073195.1.14112 WP_000073195.1.14143 WP_000073195.1.14153 WP_000073195.1.14163 WP_000073195.1.14192 WP_000073195.1.1420 WP_000073195.1.14201 WP_000073195.1.14221 WP_000073195.1.14233 WP_000073195.1.1425 WP_000073195.1.1426 WP_000073195.1.14272 WP_000073195.1.14281 WP_000073195.1.1429 WP_000073195.1.14302 WP_000073195.1.14305 WP_000073195.1.14314 WP_000073195.1.14342 WP_000073195.1.14355 WP_000073195.1.14358 WP_000073195.1.14364 WP_000073195.1.14365 WP_000073195.1.14366 WP_000073195.1.14372 WP_000073195.1.14394 WP_000073195.1.14397 WP_000073195.1.14412 WP_000073195.1.14418 WP_000073195.1.14475 WP_000073195.1.14535 WP_000073195.1.14546 WP_000073195.1.1457 WP_000073195.1.14577 WP_000073195.1.14590 WP_000073195.1.14596 WP_000073195.1.14639 WP_000073195.1.14666 WP_000073195.1.1468 WP_000073195.1.14696 WP_000073195.1.147 WP_000073195.1.1471 WP_000073195.1.14729 WP_000073195.1.14734 WP_000073195.1.14744 WP_000073195.1.1477 WP_000073195.1.14774 WP_000073195.1.14782 WP_000073195.1.14787 WP_000073195.1.14790 WP_000073195.1.14809 WP_000073195.1.14823 WP_000073195.1.14825 WP_000073195.1.14846 WP_000073195.1.14866 WP_000073195.1.14868 WP_000073195.1.14869 WP_000073195.1.14874 WP_000073195.1.14888 WP_000073195.1.1490 WP_000073195.1.14902 WP_000073195.1.14924 WP_000073195.1.14967 WP_000073195.1.14970 WP_000073195.1.14987 WP_000073195.1.15000 WP_000073195.1.15015 WP_000073195.1.15022 WP_000073195.1.15029 WP_000073195.1.15039 WP_000073195.1.15091 WP_000073195.1.15108 WP_000073195.1.15173 WP_000073195.1.15182 WP_000073195.1.15185 WP_000073195.1.1520 WP_000073195.1.15201 WP_000073195.1.15228 WP_000073195.1.15234 WP_000073195.1.15241 WP_000073195.1.1525 WP_000073195.1.15255 WP_000073195.1.15263 WP_000073195.1.15268 WP_000073195.1.15269 WP_000073195.1.15278 WP_000073195.1.15294 WP_000073195.1.15296 WP_000073195.1.15329 WP_000073195.1.15389 WP_000073195.1.15399 WP_000073195.1.15403 WP_000073195.1.15409 WP_000073195.1.15421 WP_000073195.1.15438 WP_000073195.1.1545 WP_000073195.1.15478 WP_000073195.1.15489 WP_000073195.1.15505 WP_000073195.1.15507 WP_000073195.1.15519 WP_000073195.1.15524 WP_000073195.1.15533 WP_000073195.1.15544 WP_000073195.1.15546 WP_000073195.1.15554 WP_000073195.1.15572 WP_000073195.1.1558 WP_000073195.1.15590 WP_000073195.1.15601 WP_000073195.1.1562 WP_000073195.1.1564 WP_000073195.1.15641 WP_000073195.1.15687 WP_000073195.1.1569 WP_000073195.1.15691 WP_000073195.1.15706 WP_000073195.1.15712 WP_000073195.1.15722 WP_000073195.1.15753 WP_000073195.1.15785 WP_000073195.1.1579 WP_000073195.1.15812 WP_000073195.1.15818 WP_000073195.1.1583 WP_000073195.1.15838 WP_000073195.1.1586 WP_000073195.1.15883 WP_000073195.1.15892 WP_000073195.1.15897 WP_000073195.1.15898 WP_000073195.1.159 WP_000073195.1.15920 WP_000073195.1.15921 WP_000073195.1.15925 WP_000073195.1.15928 WP_000073195.1.15939 WP_000073195.1.15957 WP_000073195.1.15972 WP_000073195.1.1599 WP_000073195.1.1600 WP_000073195.1.16018 WP_000073195.1.16026 WP_000073195.1.1606 WP_000073195.1.16068 WP_000073195.1.16083 WP_000073195.1.16095 WP_000073195.1.16096 WP_000073195.1.16098 WP_000073195.1.16112 WP_000073195.1.16114 WP_000073195.1.16140 WP_000073195.1.16173 WP_000073195.1.16195 WP_000073195.1.16203 WP_000073195.1.16213 WP_000073195.1.16223 WP_000073195.1.1623 WP_000073195.1.16237 WP_000073195.1.16251 WP_000073195.1.16265 WP_000073195.1.16276 WP_000073195.1.16283 WP_000073195.1.16311 WP_000073195.1.16362 WP_000073195.1.16372 WP_000073195.1.16395 WP_000073195.1.16407 WP_000073195.1.16408 WP_000073195.1.16414 WP_000073195.1.16417 WP_000073195.1.16433 WP_000073195.1.16455 WP_000073195.1.16458 WP_000073195.1.16467 WP_000073195.1.16554 WP_000073195.1.16564 WP_000073195.1.16569 WP_000073195.1.16589 WP_000073195.1.16606 WP_000073195.1.16617 WP_000073195.1.1662 WP_000073195.1.16628 WP_000073195.1.16632 WP_000073195.1.16639 WP_000073195.1.16649 WP_000073195.1.1665 WP_000073195.1.16651 WP_000073195.1.16653 WP_000073195.1.1666 WP_000073195.1.16664 WP_000073195.1.16672 WP_000073195.1.16679 WP_000073195.1.16684 WP_000073195.1.16688 WP_000073195.1.16693 WP_000073195.1.16703 WP_000073195.1.16747 WP_000073195.1.16757 WP_000073195.1.16762 WP_000073195.1.16768 WP_000073195.1.16770 WP_000073195.1.16776 WP_000073195.1.16794 WP_000073195.1.16802 WP_000073195.1.16815 WP_000073195.1.16824 WP_000073195.1.16833 WP_000073195.1.16880 WP_000073195.1.16882 WP_000073195.1.16892 WP_000073195.1.16920 WP_000073195.1.16925 WP_000073195.1.16936 WP_000073195.1.16938 WP_000073195.1.16946 WP_000073195.1.16969 WP_000073195.1.16986 WP_000073195.1.170 WP_000073195.1.17012 WP_000073195.1.17038 WP_000073195.1.17046 WP_000073195.1.17050 WP_000073195.1.17080 WP_000073195.1.17104 WP_000073195.1.17122 WP_000073195.1.17132 WP_000073195.1.17137 WP_000073195.1.17139 WP_000073195.1.17156 WP_000073195.1.17157 WP_000073195.1.17169 WP_000073195.1.17180 WP_000073195.1.17193 WP_000073195.1.17200 WP_000073195.1.17210 WP_000073195.1.17231 WP_000073195.1.17234 WP_000073195.1.17240 WP_000073195.1.17248 WP_000073195.1.17249 WP_000073195.1.1725 WP_000073195.1.17256 WP_000073195.1.17289 WP_000073195.1.1729 WP_000073195.1.17296 WP_000073195.1.17309 WP_000073195.1.17320 WP_000073195.1.17327 WP_000073195.1.1736 WP_000073195.1.1740 WP_000073195.1.1741 WP_000073195.1.17419 WP_000073195.1.17450 WP_000073195.1.17454 WP_000073195.1.17456 WP_000073195.1.17475 WP_000073195.1.17485 WP_000073195.1.1751 WP_000073195.1.17520 WP_000073195.1.17524 WP_000073195.1.17526 WP_000073195.1.17529 WP_000073195.1.17531 WP_000073195.1.1756 WP_000073195.1.17581 WP_000073195.1.17590 WP_000073195.1.17628 WP_000073195.1.17643 WP_000073195.1.1765 WP_000073195.1.17650 WP_000073195.1.17651 WP_000073195.1.17657 WP_000073195.1.17658 WP_000073195.1.17666 WP_000073195.1.17671 WP_000073195.1.17676 WP_000073195.1.1771 WP_000073195.1.17717 WP_000073195.1.17718 WP_000073195.1.17720 WP_000073195.1.17725 WP_000073195.1.17729 WP_000073195.1.17737 WP_000073195.1.17770 WP_000073195.1.17796 WP_000073195.1.17818 WP_000073195.1.17832 WP_000073195.1.17834 WP_000073195.1.17835 WP_000073195.1.17838 WP_000073195.1.17845 WP_000073195.1.17847 WP_000073195.1.17853 WP_000073195.1.17859 WP_000073195.1.1787 WP_000073195.1.17876 WP_000073195.1.17882 WP_000073195.1.17909 WP_000073195.1.17922 WP_000073195.1.17929 WP_000073195.1.17943 WP_000073195.1.17951 WP_000073195.1.17966 WP_000073195.1.17987 WP_000073195.1.18011 WP_000073195.1.18016 WP_000073195.1.18035 WP_000073195.1.18069 WP_000073195.1.18074 WP_000073195.1.18080 WP_000073195.1.18105 WP_000073195.1.18113 WP_000073195.1.18132 WP_000073195.1.18140 WP_000073195.1.18153 WP_000073195.1.18197 WP_000073195.1.18203 WP_000073195.1.18205 WP_000073195.1.18237 WP_000073195.1.18248 WP_000073195.1.18261 WP_000073195.1.18273 WP_000073195.1.18283 WP_000073195.1.18288 WP_000073195.1.1829 WP_000073195.1.18290 WP_000073195.1.18301 WP_000073195.1.18309 WP_000073195.1.18310 WP_000073195.1.18320 WP_000073195.1.18346 WP_000073195.1.1835 WP_000073195.1.18360 WP_000073195.1.18412 WP_000073195.1.18429 WP_000073195.1.18437 WP_000073195.1.18451 WP_000073195.1.18466 WP_000073195.1.1847 WP_000073195.1.18487 WP_000073195.1.1849 WP_000073195.1.18497 WP_000073195.1.185 WP_000073195.1.18504 WP_000073195.1.18506 WP_000073195.1.18507 WP_000073195.1.1851 WP_000073195.1.18516 WP_000073195.1.18526 WP_000073195.1.18527 WP_000073195.1.18529 WP_000073195.1.18538 WP_000073195.1.18539 WP_000073195.1.18545 WP_000073195.1.18560 WP_000073195.1.18562 WP_000073195.1.18566 WP_000073195.1.18567 WP_000073195.1.18570 WP_000073195.1.18590 WP_000073195.1.18591 WP_000073195.1.18605 WP_000073195.1.18611 WP_000073195.1.18627 WP_000073195.1.18632 WP_000073195.1.18658 WP_000073195.1.18668 WP_000073195.1.18679 WP_000073195.1.18741 WP_000073195.1.18758 WP_000073195.1.18763 WP_000073195.1.18774 WP_000073195.1.18777 WP_000073195.1.18779 WP_000073195.1.18792 WP_000073195.1.18799 WP_000073195.1.18809 WP_000073195.1.18818 WP_000073195.1.18819 WP_000073195.1.18830 WP_000073195.1.18834 WP_000073195.1.18836 WP_000073195.1.18870 WP_000073195.1.18879 WP_000073195.1.18882 WP_000073195.1.18918 WP_000073195.1.1892 WP_000073195.1.18938 WP_000073195.1.18965 WP_000073195.1.18968 WP_000073195.1.18974 WP_000073195.1.18987 WP_000073195.1.18996 WP_000073195.1.19009 WP_000073195.1.1901 WP_000073195.1.19022 WP_000073195.1.19027 WP_000073195.1.19052 WP_000073195.1.19082 WP_000073195.1.1911 WP_000073195.1.1912 WP_000073195.1.19149 WP_000073195.1.19179 WP_000073195.1.192 WP_000073195.1.19259 WP_000073195.1.19272 WP_000073195.1.19301 WP_000073195.1.19322 WP_000073195.1.19365 WP_000073195.1.19370 WP_000073195.1.19386 WP_000073195.1.19390 WP_000073195.1.19399 WP_000073195.1.19411 WP_000073195.1.19430 WP_000073195.1.19444 WP_000073195.1.19450 WP_000073195.1.19455 WP_000073195.1.19497 WP_000073195.1.19509 WP_000073195.1.19515 WP_000073195.1.19537 WP_000073195.1.19555 WP_000073195.1.19575 WP_000073195.1.19577 WP_000073195.1.19611 WP_000073195.1.1964 WP_000073195.1.19643 WP_000073195.1.19653 WP_000073195.1.19701 WP_000073195.1.19717 WP_000073195.1.19725 WP_000073195.1.19732 WP_000073195.1.19733 WP_000073195.1.1974 WP_000073195.1.19748 WP_000073195.1.1975 WP_000073195.1.19765 WP_000073195.1.19775 WP_000073195.1.19788 WP_000073195.1.19792 WP_000073195.1.19801 WP_000073195.1.19807 WP_000073195.1.19816 WP_000073195.1.19848 WP_000073195.1.19853 WP_000073195.1.19891 WP_000073195.1.19904 WP_000073195.1.19905 WP_000073195.1.19912 WP_000073195.1.19921 WP_000073195.1.19928 WP_000073195.1.19968 WP_000073195.1.19977 WP_000073195.1.19980 WP_000073195.1.19981 WP_000073195.1.19982 WP_000073195.1.2 WP_000073195.1.20006 WP_000073195.1.20049 WP_000073195.1.20052 WP_000073195.1.20057 WP_000073195.1.2007 WP_000073195.1.20078 WP_000073195.1.2008 WP_000073195.1.20090 WP_000073195.1.20100 WP_000073195.1.20101 WP_000073195.1.2013 WP_000073195.1.20155 WP_000073195.1.20156 WP_000073195.1.20160 WP_000073195.1.20161 WP_000073195.1.20167 WP_000073195.1.20177 WP_000073195.1.20191 WP_000073195.1.20201 WP_000073195.1.20210 WP_000073195.1.20214 WP_000073195.1.20219 WP_000073195.1.20221 WP_000073195.1.20235 WP_000073195.1.20245 WP_000073195.1.2025 WP_000073195.1.20265 WP_000073195.1.2029 WP_000073195.1.20307 WP_000073195.1.20324 WP_000073195.1.20340 WP_000073195.1.20354 WP_000073195.1.20358 WP_000073195.1.20386 WP_000073195.1.20394 WP_000073195.1.20398 WP_000073195.1.20399 WP_000073195.1.20411 WP_000073195.1.20447 WP_000073195.1.20473 WP_000073195.1.20479 WP_000073195.1.20487 WP_000073195.1.20496 WP_000073195.1.20500 WP_000073195.1.20512 WP_000073195.1.20550 WP_000073195.1.20554 WP_000073195.1.2056 WP_000073195.1.20574 WP_000073195.1.20579 WP_000073195.1.20585 WP_000073195.1.20598 WP_000073195.1.20611 WP_000073195.1.20618 WP_000073195.1.20619 WP_000073195.1.20620 WP_000073195.1.20649 WP_000073195.1.20661 WP_000073195.1.20690 WP_000073195.1.20698 WP_000073195.1.20736 WP_000073195.1.20772 WP_000073195.1.2079 WP_000073195.1.20796 WP_000073195.1.20821 WP_000073195.1.20833 WP_000073195.1.20838 WP_000073195.1.20846 WP_000073195.1.20860 WP_000073195.1.20866 WP_000073195.1.20867 WP_000073195.1.20878 WP_000073195.1.20906 WP_000073195.1.20913 WP_000073195.1.20922 WP_000073195.1.20935 WP_000073195.1.20939 WP_000073195.1.20945 WP_000073195.1.20971 WP_000073195.1.20975 WP_000073195.1.21009 WP_000073195.1.21013 WP_000073195.1.21015 WP_000073195.1.21031 WP_000073195.1.21036 WP_000073195.1.21054 WP_000073195.1.21056 WP_000073195.1.21066 WP_000073195.1.21078 WP_000073195.1.21080 WP_000073195.1.21081 WP_000073195.1.21109 WP_000073195.1.21111 WP_000073195.1.21140 WP_000073195.1.21154 WP_000073195.1.21183 WP_000073195.1.2119 WP_000073195.1.21222 WP_000073195.1.21257 WP_000073195.1.21259 WP_000073195.1.21272 WP_000073195.1.2128 WP_000073195.1.2129 WP_000073195.1.21312 WP_000073195.1.21313 WP_000073195.1.21314 WP_000073195.1.21330 WP_000073195.1.21339 WP_000073195.1.2135 WP_000073195.1.21356 WP_000073195.1.21359 WP_000073195.1.21375 WP_000073195.1.21379 WP_000073195.1.21386 WP_000073195.1.21393 WP_000073195.1.21402 WP_000073195.1.21412 WP_000073195.1.21416 WP_000073195.1.21449 WP_000073195.1.21458 WP_000073195.1.21464 WP_000073195.1.21465 WP_000073195.1.21477 WP_000073195.1.21480 WP_000073195.1.21500 WP_000073195.1.21505 WP_000073195.1.21511 WP_000073195.1.21514 WP_000073195.1.21572 WP_000073195.1.21583 WP_000073195.1.21589 WP_000073195.1.2159 WP_000073195.1.2160 WP_000073195.1.21601 WP_000073195.1.21621 WP_000073195.1.21636 WP_000073195.1.21679 WP_000073195.1.21712 WP_000073195.1.21719 WP_000073195.1.21724 WP_000073195.1.21746 WP_000073195.1.21763 WP_000073195.1.2178 WP_000073195.1.21787 WP_000073195.1.21820 WP_000073195.1.21828 WP_000073195.1.21830 WP_000073195.1.21890 WP_000073195.1.21900 WP_000073195.1.21901 WP_000073195.1.21919 WP_000073195.1.21985 WP_000073195.1.21988 WP_000073195.1.2200 WP_000073195.1.22000 WP_000073195.1.22011 WP_000073195.1.22027 WP_000073195.1.22033 WP_000073195.1.22038 WP_000073195.1.22045 WP_000073195.1.22049 WP_000073195.1.22065 WP_000073195.1.22082 WP_000073195.1.22111 WP_000073195.1.22149 WP_000073195.1.22163 WP_000073195.1.22164 WP_000073195.1.22165 WP_000073195.1.22170 WP_000073195.1.22174 WP_000073195.1.22177 WP_000073195.1.22180 WP_000073195.1.22197 WP_000073195.1.22227 WP_000073195.1.22246 WP_000073195.1.22302 WP_000073195.1.22307 WP_000073195.1.22332 WP_000073195.1.22344 WP_000073195.1.22351 WP_000073195.1.22367 WP_000073195.1.22369 WP_000073195.1.22400 WP_000073195.1.22419 WP_000073195.1.22426 WP_000073195.1.22441 WP_000073195.1.22493 WP_000073195.1.22498 WP_000073195.1.22512 WP_000073195.1.22526 WP_000073195.1.22531 WP_000073195.1.22533 WP_000073195.1.22547 WP_000073195.1.22551 WP_000073195.1.22559 WP_000073195.1.22650 WP_000073195.1.22657 WP_000073195.1.22684 WP_000073195.1.22696 WP_000073195.1.22702 WP_000073195.1.22709 WP_000073195.1.22730 WP_000073195.1.22731 WP_000073195.1.22738 WP_000073195.1.22764 WP_000073195.1.22787 WP_000073195.1.22789 WP_000073195.1.22790 WP_000073195.1.22792 WP_000073195.1.2280 WP_000073195.1.22803 WP_000073195.1.22808 WP_000073195.1.22811 WP_000073195.1.22826 WP_000073195.1.22843 WP_000073195.1.22853 WP_000073195.1.22859 WP_000073195.1.22861 WP_000073195.1.22869 WP_000073195.1.22890 WP_000073195.1.22924 WP_000073195.1.22969 WP_000073195.1.22983 WP_000073195.1.22984 WP_000073195.1.22994 WP_000073195.1.23004 WP_000073195.1.23008 WP_000073195.1.23012 WP_000073195.1.23048 WP_000073195.1.23061 WP_000073195.1.23082 WP_000073195.1.23103 WP_000073195.1.23121 WP_000073195.1.23130 WP_000073195.1.23132 WP_000073195.1.23133 WP_000073195.1.23146 WP_000073195.1.23152 WP_000073195.1.23161 WP_000073195.1.23185 WP_000073195.1.23194 WP_000073195.1.23197 WP_000073195.1.23222 WP_000073195.1.23228 WP_000073195.1.23238 WP_000073195.1.23244 WP_000073195.1.23251 WP_000073195.1.2327 WP_000073195.1.23275 WP_000073195.1.23288 WP_000073195.1.23304 WP_000073195.1.23381 WP_000073195.1.23413 WP_000073195.1.23420 WP_000073195.1.23431 WP_000073195.1.23439 WP_000073195.1.23449 WP_000073195.1.23450 WP_000073195.1.23476 WP_000073195.1.23489 WP_000073195.1.23491 WP_000073195.1.23517 WP_000073195.1.23531 WP_000073195.1.23541 WP_000073195.1.23544 WP_000073195.1.23557 WP_000073195.1.23572 WP_000073195.1.23580 WP_000073195.1.23586 WP_000073195.1.23613 WP_000073195.1.23617 WP_000073195.1.23630 WP_000073195.1.23644 WP_000073195.1.2365 WP_000073195.1.23671 WP_000073195.1.23690 WP_000073195.1.23708 WP_000073195.1.23710 WP_000073195.1.23730 WP_000073195.1.23740 WP_000073195.1.23796 WP_000073195.1.23809 WP_000073195.1.23822 WP_000073195.1.23842 WP_000073195.1.23849 WP_000073195.1.2389 WP_000073195.1.23900 WP_000073195.1.23902 WP_000073195.1.23907 WP_000073195.1.23926 WP_000073195.1.23935 WP_000073195.1.23944 WP_000073195.1.23956 WP_000073195.1.23972 WP_000073195.1.23995 WP_000073195.1.23998 WP_000073195.1.24000 WP_000073195.1.24081 WP_000073195.1.24148 WP_000073195.1.24154 WP_000073195.1.24167 WP_000073195.1.24174 WP_000073195.1.24207 WP_000073195.1.24213 WP_000073195.1.24226 WP_000073195.1.2423 WP_000073195.1.24241 WP_000073195.1.24263 WP_000073195.1.2427 WP_000073195.1.24276 WP_000073195.1.24277 WP_000073195.1.24286 WP_000073195.1.24302 WP_000073195.1.2434 WP_000073195.1.24343 WP_000073195.1.24347 WP_000073195.1.24364 WP_000073195.1.24365 WP_000073195.1.24388 WP_000073195.1.24418 WP_000073195.1.2442 WP_000073195.1.24437 WP_000073195.1.24443 WP_000073195.1.24462 WP_000073195.1.24469 WP_000073195.1.24478 WP_000073195.1.2450 WP_000073195.1.24502 WP_000073195.1.24503 WP_000073195.1.24516 WP_000073195.1.24519 WP_000073195.1.24569 WP_000073195.1.24572 WP_000073195.1.2458 WP_000073195.1.24589 WP_000073195.1.24596 WP_000073195.1.24597 WP_000073195.1.24602 WP_000073195.1.24617 WP_000073195.1.24625 WP_000073195.1.24631 WP_000073195.1.24644 WP_000073195.1.24654 WP_000073195.1.24674 WP_000073195.1.24679 WP_000073195.1.24681 WP_000073195.1.24684 WP_000073195.1.24685 WP_000073195.1.24702 WP_000073195.1.24711 WP_000073195.1.24714 WP_000073195.1.24745 WP_000073195.1.24780 WP_000073195.1.24781 WP_000073195.1.2480 WP_000073195.1.24802 WP_000073195.1.24817 WP_000073195.1.24823 WP_000073195.1.24834 WP_000073195.1.24855 WP_000073195.1.24856 WP_000073195.1.24891 WP_000073195.1.24903 WP_000073195.1.24918 WP_000073195.1.24937 WP_000073195.1.2497 WP_000073195.1.25001 WP_000073195.1.25007 WP_000073195.1.2501 WP_000073195.1.25012 WP_000073195.1.2506 WP_000073195.1.25070 WP_000073195.1.25083 WP_000073195.1.25092 WP_000073195.1.25095 WP_000073195.1.25098 WP_000073195.1.25115 WP_000073195.1.25117 WP_000073195.1.25120 WP_000073195.1.25145 WP_000073195.1.25167 WP_000073195.1.25170 WP_000073195.1.25187 WP_000073195.1.25209 WP_000073195.1.25216 WP_000073195.1.25221 WP_000073195.1.25262 WP_000073195.1.25287 WP_000073195.1.25288 WP_000073195.1.25331 WP_000073195.1.25341 WP_000073195.1.25345 WP_000073195.1.25361 WP_000073195.1.25433 WP_000073195.1.25438 WP_000073195.1.2544 WP_000073195.1.25459 WP_000073195.1.25469 WP_000073195.1.25479 WP_000073195.1.25488 WP_000073195.1.25489 WP_000073195.1.25495 WP_000073195.1.25511 WP_000073195.1.2552 WP_000073195.1.25557 WP_000073195.1.25567 WP_000073195.1.25569 WP_000073195.1.25591 WP_000073195.1.25593 WP_000073195.1.25595 WP_000073195.1.25597 WP_000073195.1.25621 WP_000073195.1.25623 WP_000073195.1.25633 WP_000073195.1.25634 WP_000073195.1.25651 WP_000073195.1.25721 WP_000073195.1.25732 WP_000073195.1.25737 WP_000073195.1.25744 WP_000073195.1.25758 WP_000073195.1.25770 WP_000073195.1.25772 WP_000073195.1.25779 WP_000073195.1.25801 WP_000073195.1.25802 WP_000073195.1.25820 WP_000073195.1.25840 WP_000073195.1.25856 WP_000073195.1.25857 WP_000073195.1.25867 WP_000073195.1.25868 WP_000073195.1.25881 WP_000073195.1.25891 WP_000073195.1.2590 WP_000073195.1.25910 WP_000073195.1.2592 WP_000073195.1.25924 WP_000073195.1.25929 WP_000073195.1.2593 WP_000073195.1.25930 WP_000073195.1.25955 WP_000073195.1.26006 WP_000073195.1.26012 WP_000073195.1.26015 WP_000073195.1.26039 WP_000073195.1.26050 WP_000073195.1.26058 WP_000073195.1.2608 WP_000073195.1.26086 WP_000073195.1.26094 WP_000073195.1.26106 WP_000073195.1.26143 WP_000073195.1.26169 WP_000073195.1.2621 WP_000073195.1.26225 WP_000073195.1.26226 WP_000073195.1.26255 WP_000073195.1.26266 WP_000073195.1.26271 WP_000073195.1.26276 WP_000073195.1.26283 WP_000073195.1.26290 WP_000073195.1.26293 WP_000073195.1.26298 WP_000073195.1.26306 WP_000073195.1.26307 WP_000073195.1.26314 WP_000073195.1.26315 WP_000073195.1.2633 WP_000073195.1.26340 WP_000073195.1.26345 WP_000073195.1.26346 WP_000073195.1.26354 WP_000073195.1.26359 WP_000073195.1.26364 WP_000073195.1.26370 WP_000073195.1.26399 WP_000073195.1.26404 WP_000073195.1.26405 WP_000073195.1.26424 WP_000073195.1.2643 WP_000073195.1.26431 WP_000073195.1.26481 WP_000073195.1.26506 WP_000073195.1.26533 WP_000073195.1.26555 WP_000073195.1.2656 WP_000073195.1.2658 WP_000073195.1.2661 WP_000073195.1.26626 WP_000073195.1.2664 WP_000073195.1.26650 WP_000073195.1.26662 WP_000073195.1.26663 WP_000073195.1.26664 WP_000073195.1.26677 WP_000073195.1.26692 WP_000073195.1.26713 WP_000073195.1.26726 WP_000073195.1.2673 WP_000073195.1.26733 WP_000073195.1.2674 WP_000073195.1.26771 WP_000073195.1.26772 WP_000073195.1.26773 WP_000073195.1.26778 WP_000073195.1.26790 WP_000073195.1.2680 WP_000073195.1.26804 WP_000073195.1.2684 WP_000073195.1.26840 WP_000073195.1.26864 WP_000073195.1.26865 WP_000073195.1.26884 WP_000073195.1.26886 WP_000073195.1.2689 WP_000073195.1.26903 WP_000073195.1.26905 WP_000073195.1.26927 WP_000073195.1.26938 WP_000073195.1.26944 WP_000073195.1.26947 WP_000073195.1.26958 WP_000073195.1.27013 WP_000073195.1.27042 WP_000073195.1.27053 WP_000073195.1.27083 WP_000073195.1.27097 WP_000073195.1.2710 WP_000073195.1.27120 WP_000073195.1.27127 WP_000073195.1.27147 WP_000073195.1.27154 WP_000073195.1.27160 WP_000073195.1.27166 WP_000073195.1.27170 WP_000073195.1.2718 WP_000073195.1.27182 WP_000073195.1.2719 WP_000073195.1.27199 WP_000073195.1.27207 WP_000073195.1.27226 WP_000073195.1.27237 WP_000073195.1.27246 WP_000073195.1.2725 WP_000073195.1.27262 WP_000073195.1.27293 WP_000073195.1.27294 WP_000073195.1.27303 WP_000073195.1.27311 WP_000073195.1.27323 WP_000073195.1.27333 WP_000073195.1.2734 WP_000073195.1.27345 WP_000073195.1.27379 WP_000073195.1.27384 WP_000073195.1.27387 WP_000073195.1.27413 WP_000073195.1.27415 WP_000073195.1.2744 WP_000073195.1.27447 WP_000073195.1.27448 WP_000073195.1.27455 WP_000073195.1.27456 WP_000073195.1.27457 WP_000073195.1.27468 WP_000073195.1.27489 WP_000073195.1.27516 WP_000073195.1.2753 WP_000073195.1.27539 WP_000073195.1.27551 WP_000073195.1.27562 WP_000073195.1.2759 WP_000073195.1.27590 WP_000073195.1.27605 WP_000073195.1.27608 WP_000073195.1.27614 WP_000073195.1.27615 WP_000073195.1.27621 WP_000073195.1.27622 WP_000073195.1.27628 WP_000073195.1.27640 WP_000073195.1.27646 WP_000073195.1.27654 WP_000073195.1.27662 WP_000073195.1.27667 WP_000073195.1.27670 WP_000073195.1.27673 WP_000073195.1.2768 WP_000073195.1.27689 WP_000073195.1.27717 WP_000073195.1.27720 WP_000073195.1.27739 WP_000073195.1.27744 WP_000073195.1.27748 WP_000073195.1.27765 WP_000073195.1.27787 WP_000073195.1.27793 WP_000073195.1.27830 WP_000073195.1.27834 WP_000073195.1.27854 WP_000073195.1.2795 WP_000073195.1.27950 WP_000073195.1.27953 WP_000073195.1.27972 WP_000073195.1.27999 WP_000073195.1.2800 WP_000073195.1.28007 WP_000073195.1.28016 WP_000073195.1.28025 WP_000073195.1.28063 WP_000073195.1.28071 WP_000073195.1.28074 WP_000073195.1.28081 WP_000073195.1.28088 WP_000073195.1.28091 WP_000073195.1.28105 WP_000073195.1.28107 WP_000073195.1.28117 WP_000073195.1.28138 WP_000073195.1.28147 WP_000073195.1.28158 WP_000073195.1.28173 WP_000073195.1.28191 WP_000073195.1.28207 WP_000073195.1.28213 WP_000073195.1.28226 WP_000073195.1.28230 WP_000073195.1.28253 WP_000073195.1.28257 WP_000073195.1.28274 WP_000073195.1.28298 WP_000073195.1.28315 WP_000073195.1.28319 WP_000073195.1.28334 WP_000073195.1.28336 WP_000073195.1.28337 WP_000073195.1.28347 WP_000073195.1.28358 WP_000073195.1.28360 WP_000073195.1.28376 WP_000073195.1.28381 WP_000073195.1.28388 WP_000073195.1.28392 WP_000073195.1.28394 WP_000073195.1.28399 WP_000073195.1.2840 WP_000073195.1.28400 WP_000073195.1.28426 WP_000073195.1.28430 WP_000073195.1.28477 WP_000073195.1.28490 WP_000073195.1.28498 WP_000073195.1.28501 WP_000073195.1.28502 WP_000073195.1.2852 WP_000073195.1.28526 WP_000073195.1.28527 WP_000073195.1.28532 WP_000073195.1.28578 WP_000073195.1.28580 WP_000073195.1.28605 WP_000073195.1.28629 WP_000073195.1.28636 WP_000073195.1.28650 WP_000073195.1.28652 WP_000073195.1.28672 WP_000073195.1.28675 WP_000073195.1.28690 WP_000073195.1.28691 WP_000073195.1.28710 WP_000073195.1.28720 WP_000073195.1.28725 WP_000073195.1.28763 WP_000073195.1.28784 WP_000073195.1.28785 WP_000073195.1.28833 WP_000073195.1.28848 WP_000073195.1.28862 WP_000073195.1.28866 WP_000073195.1.28871 WP_000073195.1.28887 WP_000073195.1.28909 WP_000073195.1.28915 WP_000073195.1.28933 WP_000073195.1.28934 WP_000073195.1.28960 WP_000073195.1.28970 WP_000073195.1.28981 WP_000073195.1.28987 WP_000073195.1.29014 WP_000073195.1.29052 WP_000073195.1.2906 WP_000073195.1.29060 WP_000073195.1.29090 WP_000073195.1.29091 WP_000073195.1.29107 WP_000073195.1.29110 WP_000073195.1.29112 WP_000073195.1.29155 WP_000073195.1.29166 WP_000073195.1.29170 WP_000073195.1.29187 WP_000073195.1.29188 WP_000073195.1.29207 WP_000073195.1.29226 WP_000073195.1.29242 WP_000073195.1.29243 WP_000073195.1.29250 WP_000073195.1.29263 WP_000073195.1.29272 WP_000073195.1.29276 WP_000073195.1.29282 WP_000073195.1.29285 WP_000073195.1.29312 WP_000073195.1.29315 WP_000073195.1.29329 WP_000073195.1.29340 WP_000073195.1.29366 WP_000073195.1.29368 WP_000073195.1.29372 WP_000073195.1.29373 WP_000073195.1.29375 WP_000073195.1.29381 WP_000073195.1.29395 WP_000073195.1.29420 WP_000073195.1.29433 WP_000073195.1.29445 WP_000073195.1.29453 WP_000073195.1.29468 WP_000073195.1.29479 WP_000073195.1.29483 WP_000073195.1.29484 WP_000073195.1.29511 WP_000073195.1.29522 WP_000073195.1.29541 WP_000073195.1.29553 WP_000073195.1.29554 WP_000073195.1.29557 WP_000073195.1.29561 WP_000073195.1.2957 WP_000073195.1.29571 WP_000073195.1.29596 WP_000073195.1.29644 WP_000073195.1.29676 WP_000073195.1.29692 WP_000073195.1.29709 WP_000073195.1.29710 WP_000073195.1.29716 WP_000073195.1.2972 WP_000073195.1.29736 WP_000073195.1.29744 WP_000073195.1.2975 WP_000073195.1.29758 WP_000073195.1.29781 WP_000073195.1.29788 WP_000073195.1.29805 WP_000073195.1.2981 WP_000073195.1.29826 WP_000073195.1.29862 WP_000073195.1.29885 WP_000073195.1.29902 WP_000073195.1.29905 WP_000073195.1.29918 WP_000073195.1.29956 WP_000073195.1.29963 WP_000073195.1.29981 WP_000073195.1.30012 WP_000073195.1.30023 WP_000073195.1.30033 WP_000073195.1.30047 WP_000073195.1.30051 WP_000073195.1.30057 WP_000073195.1.30089 WP_000073195.1.30095 WP_000073195.1.30100 WP_000073195.1.3012 WP_000073195.1.30150 WP_000073195.1.30152 WP_000073195.1.30154 WP_000073195.1.30159 WP_000073195.1.30169 WP_000073195.1.30176 WP_000073195.1.30186 WP_000073195.1.30188 WP_000073195.1.30190 WP_000073195.1.30197 WP_000073195.1.30203 WP_000073195.1.30204 WP_000073195.1.30209 WP_000073195.1.30230 WP_000073195.1.30249 WP_000073195.1.30262 WP_000073195.1.30268 WP_000073195.1.30274 WP_000073195.1.3029 WP_000073195.1.30294 WP_000073195.1.30302 WP_000073195.1.30307 WP_000073195.1.30328 WP_000073195.1.30333 WP_000073195.1.30350 WP_000073195.1.30364 WP_000073195.1.30367 WP_000073195.1.30376 WP_000073195.1.30381 WP_000073195.1.30392 WP_000073195.1.30418 WP_000073195.1.30422 WP_000073195.1.30458 WP_000073195.1.30477 WP_000073195.1.30482 WP_000073195.1.30496 WP_000073195.1.3050 WP_000073195.1.30508 WP_000073195.1.30530 WP_000073195.1.30531 WP_000073195.1.30560 WP_000073195.1.30600 WP_000073195.1.30622 WP_000073195.1.30623 WP_000073195.1.30645 WP_000073195.1.30646 WP_000073195.1.30666 WP_000073195.1.30668 WP_000073195.1.30690 WP_000073195.1.30702 WP_000073195.1.30720 WP_000073195.1.30726 WP_000073195.1.30758 WP_000073195.1.30763 WP_000073195.1.30768 WP_000073195.1.3077 WP_000073195.1.30779 WP_000073195.1.30845 WP_000073195.1.30846 WP_000073195.1.30847 WP_000073195.1.30854 WP_000073195.1.30861 WP_000073195.1.30862 WP_000073195.1.30863 WP_000073195.1.30874 WP_000073195.1.30878 WP_000073195.1.30889 WP_000073195.1.30911 WP_000073195.1.30915 WP_000073195.1.30916 WP_000073195.1.30945 WP_000073195.1.30962 WP_000073195.1.3097 WP_000073195.1.30970 WP_000073195.1.30971 WP_000073195.1.30998 WP_000073195.1.31005 WP_000073195.1.31022 WP_000073195.1.31037 WP_000073195.1.31039 WP_000073195.1.31048 WP_000073195.1.31068 WP_000073195.1.31091 WP_000073195.1.31114 WP_000073195.1.31120 WP_000073195.1.31123 WP_000073195.1.31124 WP_000073195.1.31176 WP_000073195.1.31194 WP_000073195.1.31202 WP_000073195.1.31204 WP_000073195.1.31206 WP_000073195.1.31212 WP_000073195.1.3123 WP_000073195.1.31232 WP_000073195.1.31294 WP_000073195.1.31315 WP_000073195.1.3132 WP_000073195.1.31337 WP_000073195.1.31339 WP_000073195.1.31355 WP_000073195.1.31363 WP_000073195.1.31376 WP_000073195.1.31402 WP_000073195.1.31424 WP_000073195.1.31426 WP_000073195.1.31436 WP_000073195.1.31437 WP_000073195.1.31442 WP_000073195.1.31462 WP_000073195.1.31468 WP_000073195.1.31478 WP_000073195.1.31479 WP_000073195.1.31484 WP_000073195.1.315 WP_000073195.1.31505 WP_000073195.1.31529 WP_000073195.1.31531 WP_000073195.1.31539 WP_000073195.1.31567 WP_000073195.1.31611 WP_000073195.1.31621 WP_000073195.1.31638 WP_000073195.1.31642 WP_000073195.1.31647 WP_000073195.1.31653 WP_000073195.1.31667 WP_000073195.1.31686 WP_000073195.1.31753 WP_000073195.1.31787 WP_000073195.1.31791 WP_000073195.1.31797 WP_000073195.1.31806 WP_000073195.1.31816 WP_000073195.1.31817 WP_000073195.1.31827 WP_000073195.1.31828 WP_000073195.1.31842 WP_000073195.1.31892 WP_000073195.1.31897 WP_000073195.1.31925 WP_000073195.1.31931 WP_000073195.1.31949 WP_000073195.1.31990 WP_000073195.1.31994 WP_000073195.1.31997 WP_000073195.1.32003 WP_000073195.1.32005 WP_000073195.1.32029 WP_000073195.1.32040 WP_000073195.1.32059 WP_000073195.1.32067 WP_000073195.1.32095 WP_000073195.1.32106 WP_000073195.1.32118 WP_000073195.1.32122 WP_000073195.1.32125 WP_000073195.1.32130 WP_000073195.1.32160 WP_000073195.1.32167 WP_000073195.1.32207 WP_000073195.1.32215 WP_000073195.1.32217 WP_000073195.1.32244 WP_000073195.1.32248 WP_000073195.1.32269 WP_000073195.1.32270 WP_000073195.1.32281 WP_000073195.1.3229 WP_000073195.1.32295 WP_000073195.1.32301 WP_000073195.1.32325 WP_000073195.1.32338 WP_000073195.1.32339 WP_000073195.1.32340 WP_000073195.1.32348 WP_000073195.1.32365 WP_000073195.1.32384 WP_000073195.1.32405 WP_000073195.1.3242 WP_000073195.1.3244 WP_000073195.1.32454 WP_000073195.1.32464 WP_000073195.1.32474 WP_000073195.1.32481 WP_000073195.1.32483 WP_000073195.1.32497 WP_000073195.1.32514 WP_000073195.1.32517 WP_000073195.1.32534 WP_000073195.1.32546 WP_000073195.1.32555 WP_000073195.1.32565 WP_000073195.1.32584 WP_000073195.1.32588 WP_000073195.1.32607 WP_000073195.1.32634 WP_000073195.1.32636 WP_000073195.1.32645 WP_000073195.1.32671 WP_000073195.1.32739 WP_000073195.1.32746 WP_000073195.1.32754 WP_000073195.1.32764 WP_000073195.1.32770 WP_000073195.1.32795 WP_000073195.1.328 WP_000073195.1.32800 WP_000073195.1.32839 WP_000073195.1.32898 WP_000073195.1.32921 WP_000073195.1.32925 WP_000073195.1.32928 WP_000073195.1.3293 WP_000073195.1.32939 WP_000073195.1.32954 WP_000073195.1.32965 WP_000073195.1.32980 WP_000073195.1.32987 WP_000073195.1.3299 WP_000073195.1.3301 WP_000073195.1.33038 WP_000073195.1.33048 WP_000073195.1.3306 WP_000073195.1.33067 WP_000073195.1.33110 WP_000073195.1.33123 WP_000073195.1.33138 WP_000073195.1.33147 WP_000073195.1.33161 WP_000073195.1.33172 WP_000073195.1.33199 WP_000073195.1.33212 WP_000073195.1.33213 WP_000073195.1.33250 WP_000073195.1.33252 WP_000073195.1.33255 WP_000073195.1.33266 WP_000073195.1.33277 WP_000073195.1.33292 WP_000073195.1.33296 WP_000073195.1.33307 WP_000073195.1.33335 WP_000073195.1.3335 WP_000073195.1.33350 WP_000073195.1.33357 WP_000073195.1.33368 WP_000073195.1.33372 WP_000073195.1.3338 WP_000073195.1.33388 WP_000073195.1.33394 WP_000073195.1.3341 WP_000073195.1.33416 WP_000073195.1.3342 WP_000073195.1.33426 WP_000073195.1.33432 WP_000073195.1.3345 WP_000073195.1.33463 WP_000073195.1.33468 WP_000073195.1.3347 WP_000073195.1.33483 WP_000073195.1.33484 WP_000073195.1.33507 WP_000073195.1.33516 WP_000073195.1.33518 WP_000073195.1.33520 WP_000073195.1.33540 WP_000073195.1.3357 WP_000073195.1.33575 WP_000073195.1.3358 WP_000073195.1.33594 WP_000073195.1.33610 WP_000073195.1.33626 WP_000073195.1.33627 WP_000073195.1.3363 WP_000073195.1.33640 WP_000073195.1.33650 WP_000073195.1.33654 WP_000073195.1.33692 WP_000073195.1.33695 WP_000073195.1.33718 WP_000073195.1.33720 WP_000073195.1.33724 WP_000073195.1.33735 WP_000073195.1.33737 WP_000073195.1.33743 WP_000073195.1.33756 WP_000073195.1.33765 WP_000073195.1.33766 WP_000073195.1.33769 WP_000073195.1.33778 WP_000073195.1.33792 WP_000073195.1.33804 WP_000073195.1.33813 WP_000073195.1.33816 WP_000073195.1.33855 WP_000073195.1.33899 WP_000073195.1.33915 WP_000073195.1.33949 WP_000073195.1.33963 WP_000073195.1.33966 WP_000073195.1.33968 WP_000073195.1.33971 WP_000073195.1.33983 WP_000073195.1.33994 WP_000073195.1.34026 WP_000073195.1.34030 WP_000073195.1.34051 WP_000073195.1.34062 WP_000073195.1.34069 WP_000073195.1.34079 WP_000073195.1.34080 WP_000073195.1.34089 WP_000073195.1.34100 WP_000073195.1.34105 WP_000073195.1.34112 WP_000073195.1.34128 WP_000073195.1.34132 WP_000073195.1.34168 WP_000073195.1.34172 WP_000073195.1.3418 WP_000073195.1.34182 WP_000073195.1.34194 WP_000073195.1.34209 WP_000073195.1.3422 WP_000073195.1.34223 WP_000073195.1.34231 WP_000073195.1.34244 WP_000073195.1.34249 WP_000073195.1.34250 WP_000073195.1.34251 WP_000073195.1.34280 WP_000073195.1.34285 WP_000073195.1.34307 WP_000073195.1.34334 WP_000073195.1.34361 WP_000073195.1.34371 WP_000073195.1.34381 WP_000073195.1.34403 WP_000073195.1.34410 WP_000073195.1.3442 WP_000073195.1.34436 WP_000073195.1.34438 WP_000073195.1.34471 WP_000073195.1.3448 WP_000073195.1.34482 WP_000073195.1.34492 WP_000073195.1.34502 WP_000073195.1.34510 WP_000073195.1.34512 WP_000073195.1.34526 WP_000073195.1.34531 WP_000073195.1.34569 WP_000073195.1.34578 WP_000073195.1.3461 WP_000073195.1.34626 WP_000073195.1.34666 WP_000073195.1.34677 WP_000073195.1.34716 WP_000073195.1.34723 WP_000073195.1.34737 WP_000073195.1.3474 WP_000073195.1.34741 WP_000073195.1.34767 WP_000073195.1.34818 WP_000073195.1.34847 WP_000073195.1.34865 WP_000073195.1.34877 WP_000073195.1.34890 WP_000073195.1.34918 WP_000073195.1.34923 WP_000073195.1.34926 WP_000073195.1.34967 WP_000073195.1.34970 WP_000073195.1.34998 WP_000073195.1.35014 WP_000073195.1.35031 WP_000073195.1.35032 WP_000073195.1.35059 WP_000073195.1.35062 WP_000073195.1.35089 WP_000073195.1.35097 WP_000073195.1.35106 WP_000073195.1.35108 WP_000073195.1.35110 WP_000073195.1.35121 WP_000073195.1.35177 WP_000073195.1.35189 WP_000073195.1.35222 WP_000073195.1.35233 WP_000073195.1.35243 WP_000073195.1.35257 WP_000073195.1.3526 WP_000073195.1.35264 WP_000073195.1.35276 WP_000073195.1.35285 WP_000073195.1.35289 WP_000073195.1.35297 WP_000073195.1.35307 WP_000073195.1.35314 WP_000073195.1.35334 WP_000073195.1.35340 WP_000073195.1.35342 WP_000073195.1.35345 WP_000073195.1.35352 WP_000073195.1.35391 WP_000073195.1.354 WP_000073195.1.35413 WP_000073195.1.35415 WP_000073195.1.3542 WP_000073195.1.35433 WP_000073195.1.35435 WP_000073195.1.3547 WP_000073195.1.35490 WP_000073195.1.35497 WP_000073195.1.35498 WP_000073195.1.35508 WP_000073195.1.35517 WP_000073195.1.35519 WP_000073195.1.3552 WP_000073195.1.35525 WP_000073195.1.35549 WP_000073195.1.35580 WP_000073195.1.35615 WP_000073195.1.35623 WP_000073195.1.35642 WP_000073195.1.35643 WP_000073195.1.35659 WP_000073195.1.35661 WP_000073195.1.35673 WP_000073195.1.35686 WP_000073195.1.35696 WP_000073195.1.35746 WP_000073195.1.35774 WP_000073195.1.35784 WP_000073195.1.3579 WP_000073195.1.35794 WP_000073195.1.35799 WP_000073195.1.35801 WP_000073195.1.35826 WP_000073195.1.35837 WP_000073195.1.35888 WP_000073195.1.35890 WP_000073195.1.35903 WP_000073195.1.35928 WP_000073195.1.35933 WP_000073195.1.35950 WP_000073195.1.36004 WP_000073195.1.36021 WP_000073195.1.36082 WP_000073195.1.36093 WP_000073195.1.36102 WP_000073195.1.36117 WP_000073195.1.36119 WP_000073195.1.36141 WP_000073195.1.3617 WP_000073195.1.36175 WP_000073195.1.36176 WP_000073195.1.36179 WP_000073195.1.36187 WP_000073195.1.36188 WP_000073195.1.36193 WP_000073195.1.36208 WP_000073195.1.36211 WP_000073195.1.36220 WP_000073195.1.36223 WP_000073195.1.3623 WP_000073195.1.36231 WP_000073195.1.36249 WP_000073195.1.36250 WP_000073195.1.36264 WP_000073195.1.36278 WP_000073195.1.36282 WP_000073195.1.36283 WP_000073195.1.36302 WP_000073195.1.36307 WP_000073195.1.36325 WP_000073195.1.36344 WP_000073195.1.36389 WP_000073195.1.36430 WP_000073195.1.36434 WP_000073195.1.36439 WP_000073195.1.36532 WP_000073195.1.36535 WP_000073195.1.3655 WP_000073195.1.36551 WP_000073195.1.36570 WP_000073195.1.36580 WP_000073195.1.36600 WP_000073195.1.36604 WP_000073195.1.36615 WP_000073195.1.36640 WP_000073195.1.36646 WP_000073195.1.3666 WP_000073195.1.36669 WP_000073195.1.36689 WP_000073195.1.36697 WP_000073195.1.36704 WP_000073195.1.36729 WP_000073195.1.36745 WP_000073195.1.3675 WP_000073195.1.36770 WP_000073195.1.36773 WP_000073195.1.36783 WP_000073195.1.36793 WP_000073195.1.36796 WP_000073195.1.36809 WP_000073195.1.36814 WP_000073195.1.36820 WP_000073195.1.36822 WP_000073195.1.36823 WP_000073195.1.36847 WP_000073195.1.3685 WP_000073195.1.36858 WP_000073195.1.3687 WP_000073195.1.36884 WP_000073195.1.36888 WP_000073195.1.36903 WP_000073195.1.36911 WP_000073195.1.36932 WP_000073195.1.36955 WP_000073195.1.36979 WP_000073195.1.36980 WP_000073195.1.36983 WP_000073195.1.36997 WP_000073195.1.37002 WP_000073195.1.37016 WP_000073195.1.3703 WP_000073195.1.37044 WP_000073195.1.37053 WP_000073195.1.37055 WP_000073195.1.37075 WP_000073195.1.37080 WP_000073195.1.3709 WP_000073195.1.37120 WP_000073195.1.37121 WP_000073195.1.37130 WP_000073195.1.37132 WP_000073195.1.37134 WP_000073195.1.37145 WP_000073195.1.37159 WP_000073195.1.3722 WP_000073195.1.37220 WP_000073195.1.37240 WP_000073195.1.37304 WP_000073195.1.37335 WP_000073195.1.37336 WP_000073195.1.37341 WP_000073195.1.37343 WP_000073195.1.37354 WP_000073195.1.37378 WP_000073195.1.37398 WP_000073195.1.37408 WP_000073195.1.37411 WP_000073195.1.37424 WP_000073195.1.37435 WP_000073195.1.37467 WP_000073195.1.37503 WP_000073195.1.37525 WP_000073195.1.37536 WP_000073195.1.37546 WP_000073195.1.37563 WP_000073195.1.37578 WP_000073195.1.37583 WP_000073195.1.37602 WP_000073195.1.37605 WP_000073195.1.37606 WP_000073195.1.37621 WP_000073195.1.37624 WP_000073195.1.37636 WP_000073195.1.37644 WP_000073195.1.37652 WP_000073195.1.37669 WP_000073195.1.37679 WP_000073195.1.3774 WP_000073195.1.37749 WP_000073195.1.3776 WP_000073195.1.37764 WP_000073195.1.37771 WP_000073195.1.37781 WP_000073195.1.37788 WP_000073195.1.37795 WP_000073195.1.37815 WP_000073195.1.37828 WP_000073195.1.3784 WP_000073195.1.37851 WP_000073195.1.37855 WP_000073195.1.37878 WP_000073195.1.37906 WP_000073195.1.37907 WP_000073195.1.37929 WP_000073195.1.37953 WP_000073195.1.37987 WP_000073195.1.38007 WP_000073195.1.38030 WP_000073195.1.38038 WP_000073195.1.38057 WP_000073195.1.38070 WP_000073195.1.38082 WP_000073195.1.3809 WP_000073195.1.38100 WP_000073195.1.38111 WP_000073195.1.38128 WP_000073195.1.38136 WP_000073195.1.38148 WP_000073195.1.38160 WP_000073195.1.38177 WP_000073195.1.3820 WP_000073195.1.38212 WP_000073195.1.38222 WP_000073195.1.38229 WP_000073195.1.38230 WP_000073195.1.38232 WP_000073195.1.3827 WP_000073195.1.38276 WP_000073195.1.38282 WP_000073195.1.38304 WP_000073195.1.38309 WP_000073195.1.38311 WP_000073195.1.38316 WP_000073195.1.38330 WP_000073195.1.38336 WP_000073195.1.38339 WP_000073195.1.38346 WP_000073195.1.38383 WP_000073195.1.38390 WP_000073195.1.3842 WP_000073195.1.38422 WP_000073195.1.38435 WP_000073195.1.38437 WP_000073195.1.38453 WP_000073195.1.38489 WP_000073195.1.38491 WP_000073195.1.38493 WP_000073195.1.3850 WP_000073195.1.38516 WP_000073195.1.3852 WP_000073195.1.38522 WP_000073195.1.38546 WP_000073195.1.38551 WP_000073195.1.38555 WP_000073195.1.38600 WP_000073195.1.38607 WP_000073195.1.38612 WP_000073195.1.38651 WP_000073195.1.38658 WP_000073195.1.3867 WP_000073195.1.38674 WP_000073195.1.38688 WP_000073195.1.38721 WP_000073195.1.3875 WP_000073195.1.38760 WP_000073195.1.38788 WP_000073195.1.38823 WP_000073195.1.38836 WP_000073195.1.38841 WP_000073195.1.38858 WP_000073195.1.38862 WP_000073195.1.38875 WP_000073195.1.38885 WP_000073195.1.38890 WP_000073195.1.38926 WP_000073195.1.38927 WP_000073195.1.38931 WP_000073195.1.3894 WP_000073195.1.38940 WP_000073195.1.38941 WP_000073195.1.38960 WP_000073195.1.38972 WP_000073195.1.38973 WP_000073195.1.38989 WP_000073195.1.390 WP_000073195.1.39012 WP_000073195.1.39014 WP_000073195.1.39017 WP_000073195.1.39020 WP_000073195.1.39026 WP_000073195.1.39043 WP_000073195.1.39053 WP_000073195.1.3906 WP_000073195.1.39080 WP_000073195.1.39089 WP_000073195.1.391 WP_000073195.1.39108 WP_000073195.1.39117 WP_000073195.1.39126 WP_000073195.1.39166 WP_000073195.1.39173 WP_000073195.1.39203 WP_000073195.1.39206 WP_000073195.1.39217 WP_000073195.1.3926 WP_000073195.1.39272 WP_000073195.1.39281 WP_000073195.1.39290 WP_000073195.1.39324 WP_000073195.1.39330 WP_000073195.1.39332 WP_000073195.1.39333 WP_000073195.1.39347 WP_000073195.1.39361 WP_000073195.1.39368 WP_000073195.1.39384 WP_000073195.1.39397 WP_000073195.1.39406 WP_000073195.1.39432 WP_000073195.1.39451 WP_000073195.1.39486 WP_000073195.1.39494 WP_000073195.1.39499 WP_000073195.1.39506 WP_000073195.1.39527 WP_000073195.1.39542 WP_000073195.1.39550 WP_000073195.1.39625 WP_000073195.1.39642 WP_000073195.1.39645 WP_000073195.1.39662 WP_000073195.1.39670 WP_000073195.1.39671 WP_000073195.1.39682 WP_000073195.1.39687 WP_000073195.1.39689 WP_000073195.1.39693 WP_000073195.1.39697 WP_000073195.1.39711 WP_000073195.1.39738 WP_000073195.1.39767 WP_000073195.1.39773 WP_000073195.1.39789 WP_000073195.1.39812 WP_000073195.1.39832 WP_000073195.1.39834 WP_000073195.1.39838 WP_000073195.1.39839 WP_000073195.1.39847 WP_000073195.1.39856 WP_000073195.1.39857 WP_000073195.1.39869 WP_000073195.1.39875 WP_000073195.1.39880 WP_000073195.1.39883 WP_000073195.1.39918 WP_000073195.1.39943 WP_000073195.1.39995 WP_000073195.1.40014 WP_000073195.1.40043 WP_000073195.1.40053 WP_000073195.1.4006 WP_000073195.1.40076 WP_000073195.1.40082 WP_000073195.1.40085 WP_000073195.1.40099 WP_000073195.1.4010 WP_000073195.1.40119 WP_000073195.1.4012 WP_000073195.1.40120 WP_000073195.1.40130 WP_000073195.1.40137 WP_000073195.1.40149 WP_000073195.1.4015 WP_000073195.1.40161 WP_000073195.1.40164 WP_000073195.1.40173 WP_000073195.1.4019 WP_000073195.1.40220 WP_000073195.1.40247 WP_000073195.1.4025 WP_000073195.1.40299 WP_000073195.1.40316 WP_000073195.1.40318 WP_000073195.1.40320 WP_000073195.1.40322 WP_000073195.1.40329 WP_000073195.1.40330 WP_000073195.1.40340 WP_000073195.1.40342 WP_000073195.1.40368 WP_000073195.1.40369 WP_000073195.1.40406 WP_000073195.1.40409 WP_000073195.1.40428 WP_000073195.1.40435 WP_000073195.1.40443 WP_000073195.1.4045 WP_000073195.1.40454 WP_000073195.1.40458 WP_000073195.1.40463 WP_000073195.1.40472 WP_000073195.1.40474 WP_000073195.1.40481 WP_000073195.1.40483 WP_000073195.1.40500 WP_000073195.1.40505 WP_000073195.1.40531 WP_000073195.1.40532 WP_000073195.1.4056 WP_000073195.1.4057 WP_000073195.1.40579 WP_000073195.1.40588 WP_000073195.1.40613 WP_000073195.1.40620 WP_000073195.1.40644 WP_000073195.1.40655 WP_000073195.1.40658 WP_000073195.1.40659 WP_000073195.1.40670 WP_000073195.1.40700 WP_000073195.1.40719 WP_000073195.1.40729 WP_000073195.1.40760 WP_000073195.1.4078 WP_000073195.1.40780 WP_000073195.1.40794 WP_000073195.1.40797 WP_000073195.1.40814 WP_000073195.1.40816 WP_000073195.1.40939 WP_000073195.1.40954 WP_000073195.1.40997 WP_000073195.1.41002 WP_000073195.1.41033 WP_000073195.1.41038 WP_000073195.1.4105 WP_000073195.1.41064 WP_000073195.1.41084 WP_000073195.1.41094 WP_000073195.1.41098 WP_000073195.1.41109 WP_000073195.1.41119 WP_000073195.1.41129 WP_000073195.1.4115 WP_000073195.1.41178 WP_000073195.1.412 WP_000073195.1.41208 WP_000073195.1.41238 WP_000073195.1.41241 WP_000073195.1.41245 WP_000073195.1.41255 WP_000073195.1.41288 WP_000073195.1.41289 WP_000073195.1.4129 WP_000073195.1.41314 WP_000073195.1.41341 WP_000073195.1.41350 WP_000073195.1.41374 WP_000073195.1.4138 WP_000073195.1.41386 WP_000073195.1.41389 WP_000073195.1.41411 WP_000073195.1.41426 WP_000073195.1.41432 WP_000073195.1.41433 WP_000073195.1.41444 WP_000073195.1.41448 WP_000073195.1.41456 WP_000073195.1.41458 WP_000073195.1.41461 WP_000073195.1.41499 WP_000073195.1.41511 WP_000073195.1.41537 WP_000073195.1.41555 WP_000073195.1.41558 WP_000073195.1.41567 WP_000073195.1.41581 WP_000073195.1.41582 WP_000073195.1.41587 WP_000073195.1.41597 WP_000073195.1.41598 WP_000073195.1.41599 WP_000073195.1.4160 WP_000073195.1.41612 WP_000073195.1.4162 WP_000073195.1.41620 WP_000073195.1.41623 WP_000073195.1.41647 WP_000073195.1.41674 WP_000073195.1.41681 WP_000073195.1.4169 WP_000073195.1.41698 WP_000073195.1.41726 WP_000073195.1.41743 WP_000073195.1.41755 WP_000073195.1.41770 WP_000073195.1.41796 WP_000073195.1.4182 WP_000073195.1.41821 WP_000073195.1.41839 WP_000073195.1.41863 WP_000073195.1.4188 WP_000073195.1.41898 WP_000073195.1.41906 WP_000073195.1.41935 WP_000073195.1.41943 WP_000073195.1.41954 WP_000073195.1.41972 WP_000073195.1.41983 WP_000073195.1.41989 WP_000073195.1.420 WP_000073195.1.42003 WP_000073195.1.42005 WP_000073195.1.42015 WP_000073195.1.42017 WP_000073195.1.4202 WP_000073195.1.42028 WP_000073195.1.42056 WP_000073195.1.42064 WP_000073195.1.42072 WP_000073195.1.42085 WP_000073195.1.42087 WP_000073195.1.42125 WP_000073195.1.42137 WP_000073195.1.42169 WP_000073195.1.42177 WP_000073195.1.42178 WP_000073195.1.42198 WP_000073195.1.42230 WP_000073195.1.42241 WP_000073195.1.4225 WP_000073195.1.42269 WP_000073195.1.42286 WP_000073195.1.42298 WP_000073195.1.42305 WP_000073195.1.4231 WP_000073195.1.42325 WP_000073195.1.42336 WP_000073195.1.42344 WP_000073195.1.42355 WP_000073195.1.42403 WP_000073195.1.42436 WP_000073195.1.42438 WP_000073195.1.42455 WP_000073195.1.42459 WP_000073195.1.42481 WP_000073195.1.42503 WP_000073195.1.42510 WP_000073195.1.42517 WP_000073195.1.42575 WP_000073195.1.42593 WP_000073195.1.42598 WP_000073195.1.426 WP_000073195.1.4260 WP_000073195.1.42607 WP_000073195.1.42640 WP_000073195.1.42652 WP_000073195.1.42667 WP_000073195.1.42668 WP_000073195.1.42674 WP_000073195.1.42679 WP_000073195.1.42681 WP_000073195.1.42706 WP_000073195.1.42733 WP_000073195.1.42737 WP_000073195.1.42759 WP_000073195.1.42764 WP_000073195.1.42786 WP_000073195.1.42788 WP_000073195.1.42798 WP_000073195.1.42802 WP_000073195.1.42816 WP_000073195.1.42837 WP_000073195.1.42893 WP_000073195.1.42897 WP_000073195.1.42907 WP_000073195.1.42924 WP_000073195.1.42925 WP_000073195.1.4293 WP_000073195.1.42959 WP_000073195.1.42982 WP_000073195.1.42984 WP_000073195.1.42985 WP_000073195.1.4299 WP_000073195.1.42990 WP_000073195.1.4300 WP_000073195.1.43014 WP_000073195.1.43023 WP_000073195.1.43033 WP_000073195.1.43047 WP_000073195.1.43061 WP_000073195.1.43072 WP_000073195.1.43095 WP_000073195.1.43110 WP_000073195.1.43122 WP_000073195.1.43125 WP_000073195.1.43131 WP_000073195.1.43134 WP_000073195.1.43139 WP_000073195.1.43143 WP_000073195.1.43147 WP_000073195.1.43159 WP_000073195.1.43165 WP_000073195.1.43168 WP_000073195.1.43179 WP_000073195.1.43202 WP_000073195.1.43204 WP_000073195.1.43220 WP_000073195.1.43225 WP_000073195.1.43232 WP_000073195.1.43248 WP_000073195.1.4325 WP_000073195.1.43252 WP_000073195.1.43263 WP_000073195.1.4327 WP_000073195.1.43274 WP_000073195.1.43279 WP_000073195.1.43323 WP_000073195.1.43325 WP_000073195.1.43328 WP_000073195.1.43331 WP_000073195.1.43341 WP_000073195.1.43349 WP_000073195.1.43360 WP_000073195.1.43366 WP_000073195.1.43369 WP_000073195.1.4337 WP_000073195.1.43375 WP_000073195.1.43405 WP_000073195.1.43406 WP_000073195.1.4341 WP_000073195.1.43410 WP_000073195.1.43414 WP_000073195.1.43446 WP_000073195.1.43460 WP_000073195.1.4347 WP_000073195.1.43512 WP_000073195.1.43530 WP_000073195.1.43550 WP_000073195.1.43560 WP_000073195.1.43573 WP_000073195.1.43594 WP_000073195.1.43600 WP_000073195.1.43617 WP_000073195.1.43618 WP_000073195.1.43627 WP_000073195.1.43659 WP_000073195.1.43665 WP_000073195.1.43670 WP_000073195.1.43683 WP_000073195.1.43693 WP_000073195.1.4370 WP_000073195.1.43702 WP_000073195.1.43703 WP_000073195.1.4372 WP_000073195.1.43731 WP_000073195.1.4374 WP_000073195.1.43752 WP_000073195.1.43784 WP_000073195.1.43788 WP_000073195.1.4379 WP_000073195.1.4380 WP_000073195.1.43800 WP_000073195.1.43819 WP_000073195.1.43822 WP_000073195.1.43827 WP_000073195.1.4385 WP_000073195.1.43851 WP_000073195.1.4386 WP_000073195.1.43904 WP_000073195.1.43915 WP_000073195.1.43924 WP_000073195.1.43964 WP_000073195.1.43984 WP_000073195.1.43995 WP_000073195.1.44021 WP_000073195.1.44072 WP_000073195.1.44074 WP_000073195.1.44095 WP_000073195.1.44119 WP_000073195.1.44150 WP_000073195.1.44153 WP_000073195.1.44177 WP_000073195.1.44178 WP_000073195.1.44181 WP_000073195.1.44195 WP_000073195.1.44255 WP_000073195.1.44265 WP_000073195.1.44302 WP_000073195.1.44312 WP_000073195.1.44344 WP_000073195.1.44382 WP_000073195.1.44388 WP_000073195.1.44396 WP_000073195.1.44405 WP_000073195.1.44420 WP_000073195.1.44432 WP_000073195.1.44455 WP_000073195.1.44480 WP_000073195.1.44493 WP_000073195.1.44504 WP_000073195.1.44515 WP_000073195.1.44517 WP_000073195.1.44520 WP_000073195.1.44544 WP_000073195.1.44547 WP_000073195.1.44579 WP_000073195.1.44586 WP_000073195.1.44588 WP_000073195.1.44605 WP_000073195.1.44623 WP_000073195.1.44631 WP_000073195.1.44646 WP_000073195.1.44655 WP_000073195.1.44667 WP_000073195.1.44672 WP_000073195.1.44674 WP_000073195.1.447 WP_000073195.1.44714 WP_000073195.1.44715 WP_000073195.1.44732 WP_000073195.1.44755 WP_000073195.1.44768 WP_000073195.1.44780 WP_000073195.1.44785 WP_000073195.1.44788 WP_000073195.1.44796 WP_000073195.1.44802 WP_000073195.1.44853 WP_000073195.1.44856 WP_000073195.1.44868 WP_000073195.1.44876 WP_000073195.1.44881 WP_000073195.1.44882 WP_000073195.1.44891 WP_000073195.1.44892 WP_000073195.1.44899 WP_000073195.1.44903 WP_000073195.1.44914 WP_000073195.1.44932 WP_000073195.1.44940 WP_000073195.1.44948 WP_000073195.1.44955 WP_000073195.1.44969 WP_000073195.1.44993 WP_000073195.1.45010 WP_000073195.1.45015 WP_000073195.1.45033 WP_000073195.1.45035 WP_000073195.1.45042 WP_000073195.1.45050 WP_000073195.1.45080 WP_000073195.1.45091 WP_000073195.1.45094 WP_000073195.1.45099 WP_000073195.1.45101 WP_000073195.1.45111 WP_000073195.1.4513 WP_000073195.1.45131 WP_000073195.1.45132 WP_000073195.1.45133 WP_000073195.1.45140 WP_000073195.1.45157 WP_000073195.1.45162 WP_000073195.1.45164 WP_000073195.1.45170 WP_000073195.1.45188 WP_000073195.1.45189 WP_000073195.1.452 WP_000073195.1.45218 WP_000073195.1.45223 WP_000073195.1.45242 WP_000073195.1.45267 WP_000073195.1.4527 WP_000073195.1.45272 WP_000073195.1.45281 WP_000073195.1.45290 WP_000073195.1.45297 WP_000073195.1.453 WP_000073195.1.45303 WP_000073195.1.45321 WP_000073195.1.45332 WP_000073195.1.45364 WP_000073195.1.45419 WP_000073195.1.45431 WP_000073195.1.45439 WP_000073195.1.45447 WP_000073195.1.4545 WP_000073195.1.45450 WP_000073195.1.45456 WP_000073195.1.4546 WP_000073195.1.45472 WP_000073195.1.45492 WP_000073195.1.4550 WP_000073195.1.45507 WP_000073195.1.45542 WP_000073195.1.45555 WP_000073195.1.45560 WP_000073195.1.45574 WP_000073195.1.45577 WP_000073195.1.45586 WP_000073195.1.45610 WP_000073195.1.45620 WP_000073195.1.45640 WP_000073195.1.45645 WP_000073195.1.45654 WP_000073195.1.45670 WP_000073195.1.45698 WP_000073195.1.45703 WP_000073195.1.45705 WP_000073195.1.45713 WP_000073195.1.45730 WP_000073195.1.45734 WP_000073195.1.45747 WP_000073195.1.45763 WP_000073195.1.45768 WP_000073195.1.4577 WP_000073195.1.45771 WP_000073195.1.45773 WP_000073195.1.45780 WP_000073195.1.4580 WP_000073195.1.4582 WP_000073195.1.45822 WP_000073195.1.45833 WP_000073195.1.4584 WP_000073195.1.45852 WP_000073195.1.45859 WP_000073195.1.45862 WP_000073195.1.45870 WP_000073195.1.45874 WP_000073195.1.45875 WP_000073195.1.45881 WP_000073195.1.45888 WP_000073195.1.45897 WP_000073195.1.459 WP_000073195.1.45954 WP_000073195.1.4597 WP_000073195.1.45972 WP_000073195.1.45977 WP_000073195.1.45979 WP_000073195.1.4598 WP_000073195.1.46003 WP_000073195.1.46005 WP_000073195.1.46021 WP_000073195.1.46035 WP_000073195.1.46037 WP_000073195.1.46050 WP_000073195.1.46055 WP_000073195.1.46062 WP_000073195.1.46071 WP_000073195.1.46078 WP_000073195.1.46082 WP_000073195.1.46087 WP_000073195.1.46106 WP_000073195.1.46136 WP_000073195.1.46168 WP_000073195.1.46171 WP_000073195.1.46172 WP_000073195.1.46185 WP_000073195.1.46195 WP_000073195.1.46208 WP_000073195.1.46212 WP_000073195.1.46222 WP_000073195.1.46228 WP_000073195.1.46248 WP_000073195.1.46259 WP_000073195.1.46276 WP_000073195.1.46289 WP_000073195.1.46320 WP_000073195.1.46330 WP_000073195.1.46333 WP_000073195.1.46334 WP_000073195.1.46339 WP_000073195.1.46353 WP_000073195.1.46362 WP_000073195.1.46368 WP_000073195.1.46380 WP_000073195.1.46389 WP_000073195.1.46401 WP_000073195.1.46418 WP_000073195.1.46422 WP_000073195.1.46457 WP_000073195.1.46465 WP_000073195.1.46488 WP_000073195.1.46514 WP_000073195.1.46528 WP_000073195.1.46529 WP_000073195.1.46534 WP_000073195.1.46543 WP_000073195.1.46576 WP_000073195.1.46587 WP_000073195.1.46608 WP_000073195.1.46619 WP_000073195.1.4662 WP_000073195.1.46648 WP_000073195.1.46660 WP_000073195.1.46664 WP_000073195.1.46670 WP_000073195.1.46676 WP_000073195.1.46688 WP_000073195.1.46692 WP_000073195.1.46696 WP_000073195.1.46702 WP_000073195.1.46703 WP_000073195.1.46720 WP_000073195.1.46736 WP_000073195.1.46752 WP_000073195.1.46765 WP_000073195.1.46767 WP_000073195.1.46770 WP_000073195.1.46772 WP_000073195.1.4680 WP_000073195.1.46815 WP_000073195.1.46823 WP_000073195.1.46837 WP_000073195.1.46852 WP_000073195.1.46875 WP_000073195.1.46881 WP_000073195.1.46906 WP_000073195.1.46908 WP_000073195.1.46911 WP_000073195.1.46914 WP_000073195.1.46925 WP_000073195.1.46929 WP_000073195.1.46937 WP_000073195.1.4694 WP_000073195.1.46947 WP_000073195.1.4696 WP_000073195.1.46964 WP_000073195.1.46983 WP_000073195.1.46995 WP_000073195.1.47002 WP_000073195.1.47051 WP_000073195.1.47065 WP_000073195.1.47090 WP_000073195.1.47105 WP_000073195.1.47107 WP_000073195.1.47111 WP_000073195.1.47128 WP_000073195.1.47153 WP_000073195.1.47159 WP_000073195.1.4716 WP_000073195.1.47163 WP_000073195.1.47175 WP_000073195.1.47187 WP_000073195.1.47193 WP_000073195.1.47205 WP_000073195.1.47211 WP_000073195.1.47216 WP_000073195.1.47218 WP_000073195.1.47250 WP_000073195.1.47258 WP_000073195.1.47269 WP_000073195.1.47279 WP_000073195.1.4728 WP_000073195.1.47282 WP_000073195.1.47290 WP_000073195.1.47294 WP_000073195.1.47306 WP_000073195.1.47308 WP_000073195.1.47317 WP_000073195.1.47328 WP_000073195.1.47331 WP_000073195.1.47334 WP_000073195.1.47353 WP_000073195.1.47381 WP_000073195.1.47383 WP_000073195.1.47399 WP_000073195.1.47405 WP_000073195.1.47406 WP_000073195.1.47408 WP_000073195.1.47422 WP_000073195.1.47426 WP_000073195.1.47432 WP_000073195.1.47439 WP_000073195.1.47450 WP_000073195.1.47459 WP_000073195.1.47493 WP_000073195.1.4752 WP_000073195.1.47522 WP_000073195.1.47530 WP_000073195.1.47541 WP_000073195.1.47554 WP_000073195.1.47560 WP_000073195.1.47561 WP_000073195.1.47570 WP_000073195.1.47577 WP_000073195.1.47617 WP_000073195.1.47618 WP_000073195.1.47629 WP_000073195.1.47667 WP_000073195.1.47669 WP_000073195.1.4767 WP_000073195.1.47680 WP_000073195.1.477 WP_000073195.1.47702 WP_000073195.1.47733 WP_000073195.1.47747 WP_000073195.1.47763 WP_000073195.1.47782 WP_000073195.1.47792 WP_000073195.1.47821 WP_000073195.1.47835 WP_000073195.1.47836 WP_000073195.1.47851 WP_000073195.1.47864 WP_000073195.1.47872 WP_000073195.1.47873 WP_000073195.1.47888 WP_000073195.1.47901 WP_000073195.1.47904 WP_000073195.1.47908 WP_000073195.1.4792 WP_000073195.1.47951 WP_000073195.1.47980 WP_000073195.1.47996 WP_000073195.1.48009 WP_000073195.1.48011 WP_000073195.1.48013 WP_000073195.1.48017 WP_000073195.1.48030 WP_000073195.1.48046 WP_000073195.1.48047 WP_000073195.1.4805 WP_000073195.1.48057 WP_000073195.1.48064 WP_000073195.1.48067 WP_000073195.1.48116 WP_000073195.1.48142 WP_000073195.1.48149 WP_000073195.1.4815 WP_000073195.1.48154 WP_000073195.1.48156 WP_000073195.1.48169 WP_000073195.1.48186 WP_000073195.1.48187 WP_000073195.1.48197 WP_000073195.1.48199 WP_000073195.1.48205 WP_000073195.1.48212 WP_000073195.1.48223 WP_000073195.1.48227 WP_000073195.1.48250 WP_000073195.1.48272 WP_000073195.1.48282 WP_000073195.1.48284 WP_000073195.1.48293 WP_000073195.1.48307 WP_000073195.1.48310 WP_000073195.1.48322 WP_000073195.1.48326 WP_000073195.1.48335 WP_000073195.1.48338 WP_000073195.1.48364 WP_000073195.1.48376 WP_000073195.1.48391 WP_000073195.1.48394 WP_000073195.1.48398 WP_000073195.1.484 WP_000073195.1.4840 WP_000073195.1.48427 WP_000073195.1.48437 WP_000073195.1.48438 WP_000073195.1.48463 WP_000073195.1.48479 WP_000073195.1.48492 WP_000073195.1.4852 WP_000073195.1.48556 WP_000073195.1.48563 WP_000073195.1.48577 WP_000073195.1.48580 WP_000073195.1.48593 WP_000073195.1.48601 WP_000073195.1.48634 WP_000073195.1.48655 WP_000073195.1.48656 WP_000073195.1.48664 WP_000073195.1.48670 WP_000073195.1.4868 WP_000073195.1.48694 WP_000073195.1.48705 WP_000073195.1.48711 WP_000073195.1.48723 WP_000073195.1.48769 WP_000073195.1.48782 WP_000073195.1.48786 WP_000073195.1.48805 WP_000073195.1.48817 WP_000073195.1.48823 WP_000073195.1.48833 WP_000073195.1.48835 WP_000073195.1.4886 WP_000073195.1.48869 WP_000073195.1.48936 WP_000073195.1.48941 WP_000073195.1.48943 WP_000073195.1.48945 WP_000073195.1.48951 WP_000073195.1.48966 WP_000073195.1.48968 WP_000073195.1.48982 WP_000073195.1.48993 WP_000073195.1.48996 WP_000073195.1.4901 WP_000073195.1.49018 WP_000073195.1.49032 WP_000073195.1.4905 WP_000073195.1.49071 WP_000073195.1.49094 WP_000073195.1.49105 WP_000073195.1.49128 WP_000073195.1.49129 WP_000073195.1.49143 WP_000073195.1.49150 WP_000073195.1.49152 WP_000073195.1.49159 WP_000073195.1.4916 WP_000073195.1.49161 WP_000073195.1.4917 WP_000073195.1.49171 WP_000073195.1.4918 WP_000073195.1.49189 WP_000073195.1.49196 WP_000073195.1.49199 WP_000073195.1.4920 WP_000073195.1.49207 WP_000073195.1.4921 WP_000073195.1.49227 WP_000073195.1.4924 WP_000073195.1.49248 WP_000073195.1.49257 WP_000073195.1.49301 WP_000073195.1.49326 WP_000073195.1.49327 WP_000073195.1.49362 WP_000073195.1.49398 WP_000073195.1.49418 WP_000073195.1.49444 WP_000073195.1.4945 WP_000073195.1.49479 WP_000073195.1.49484 WP_000073195.1.4950 WP_000073195.1.49518 WP_000073195.1.49530 WP_000073195.1.49539 WP_000073195.1.49549 WP_000073195.1.49573 WP_000073195.1.49581 WP_000073195.1.49582 WP_000073195.1.496 WP_000073195.1.49603 WP_000073195.1.49605 WP_000073195.1.4962 WP_000073195.1.49643 WP_000073195.1.49653 WP_000073195.1.49658 WP_000073195.1.49669 WP_000073195.1.49671 WP_000073195.1.49672 WP_000073195.1.49690 WP_000073195.1.49707 WP_000073195.1.49728 WP_000073195.1.49730 WP_000073195.1.49732 WP_000073195.1.49742 WP_000073195.1.49745 WP_000073195.1.49757 WP_000073195.1.4980 WP_000073195.1.49800 WP_000073195.1.49819 WP_000073195.1.4982 WP_000073195.1.49825 WP_000073195.1.4984 WP_000073195.1.49860 WP_000073195.1.49863 WP_000073195.1.4987 WP_000073195.1.49871 WP_000073195.1.4989 WP_000073195.1.49894 WP_000073195.1.49907 WP_000073195.1.49912 WP_000073195.1.49917 WP_000073195.1.49918 WP_000073195.1.49921 WP_000073195.1.49934 WP_000073195.1.49935 WP_000073195.1.4994 WP_000073195.1.49943 WP_000073195.1.49951 WP_000073195.1.49970 WP_000073195.1.49982 WP_000073195.1.50013 WP_000073195.1.50023 WP_000073195.1.50028 WP_000073195.1.50038 WP_000073195.1.50039 WP_000073195.1.50061 WP_000073195.1.50064 WP_000073195.1.50071 WP_000073195.1.50076 WP_000073195.1.50117 WP_000073195.1.5013 WP_000073195.1.50138 WP_000073195.1.50145 WP_000073195.1.50175 WP_000073195.1.50178 WP_000073195.1.50192 WP_000073195.1.50212 WP_000073195.1.50217 WP_000073195.1.50219 WP_000073195.1.50261 WP_000073195.1.50291 WP_000073195.1.50313 WP_000073195.1.50314 WP_000073195.1.5035 WP_000073195.1.50356 WP_000073195.1.50367 WP_000073195.1.50369 WP_000073195.1.50377 WP_000073195.1.50388 WP_000073195.1.50424 WP_000073195.1.50425 WP_000073195.1.50430 WP_000073195.1.50440 WP_000073195.1.5045 WP_000073195.1.50464 WP_000073195.1.50477 WP_000073195.1.50525 WP_000073195.1.50527 WP_000073195.1.50536 WP_000073195.1.50543 WP_000073195.1.50555 WP_000073195.1.50558 WP_000073195.1.50568 WP_000073195.1.50578 WP_000073195.1.5059 WP_000073195.1.50594 WP_000073195.1.50595 WP_000073195.1.50647 WP_000073195.1.50660 WP_000073195.1.50699 WP_000073195.1.50711 WP_000073195.1.50732 WP_000073195.1.50740 WP_000073195.1.50742 WP_000073195.1.50745 WP_000073195.1.50748 WP_000073195.1.50768 WP_000073195.1.50799 WP_000073195.1.5080 WP_000073195.1.50817 WP_000073195.1.50820 WP_000073195.1.50829 WP_000073195.1.5087 WP_000073195.1.50884 WP_000073195.1.50896 WP_000073195.1.50937 WP_000073195.1.50958 WP_000073195.1.50962 WP_000073195.1.50974 WP_000073195.1.51015 WP_000073195.1.51031 WP_000073195.1.5108 WP_000073195.1.5109 WP_000073195.1.5110 WP_000073195.1.5111 WP_000073195.1.51130 WP_000073195.1.51152 WP_000073195.1.5117 WP_000073195.1.51194 WP_000073195.1.51209 WP_000073195.1.51220 WP_000073195.1.51236 WP_000073195.1.51245 WP_000073195.1.51250 WP_000073195.1.51271 WP_000073195.1.51277 WP_000073195.1.51282 WP_000073195.1.51295 WP_000073195.1.51306 WP_000073195.1.51310 WP_000073195.1.51326 WP_000073195.1.51346 WP_000073195.1.51365 WP_000073195.1.51376 WP_000073195.1.51377 WP_000073195.1.51393 WP_000073195.1.51403 WP_000073195.1.51418 WP_000073195.1.5145 WP_000073195.1.51454 WP_000073195.1.51456 WP_000073195.1.51465 WP_000073195.1.51469 WP_000073195.1.51492 WP_000073195.1.51496 WP_000073195.1.515 WP_000073195.1.51527 WP_000073195.1.5155 WP_000073195.1.51557 WP_000073195.1.51558 WP_000073195.1.51559 WP_000073195.1.51571 WP_000073195.1.51590 WP_000073195.1.51619 WP_000073195.1.51623 WP_000073195.1.51657 WP_000073195.1.51665 WP_000073195.1.51672 WP_000073195.1.51702 WP_000073195.1.51713 WP_000073195.1.51716 WP_000073195.1.51741 WP_000073195.1.51744 WP_000073195.1.51748 WP_000073195.1.51751 WP_000073195.1.51794 WP_000073195.1.51797 WP_000073195.1.51824 WP_000073195.1.51836 WP_000073195.1.51842 WP_000073195.1.51844 WP_000073195.1.5186 WP_000073195.1.51866 WP_000073195.1.51871 WP_000073195.1.51883 WP_000073195.1.51912 WP_000073195.1.51924 WP_000073195.1.51936 WP_000073195.1.51952 WP_000073195.1.51971 WP_000073195.1.51973 WP_000073195.1.51995 WP_000073195.1.52034 WP_000073195.1.52061 WP_000073195.1.52072 WP_000073195.1.52078 WP_000073195.1.5209 WP_000073195.1.521 WP_000073195.1.5213 WP_000073195.1.52182 WP_000073195.1.52185 WP_000073195.1.52193 WP_000073195.1.52195 WP_000073195.1.52198 WP_000073195.1.52210 WP_000073195.1.52224 WP_000073195.1.52251 WP_000073195.1.5228 WP_000073195.1.52289 WP_000073195.1.52296 WP_000073195.1.523 WP_000073195.1.52308 WP_000073195.1.5231 WP_000073195.1.52322 WP_000073195.1.52327 WP_000073195.1.52331 WP_000073195.1.52340 WP_000073195.1.52343 WP_000073195.1.52377 WP_000073195.1.52396 WP_000073195.1.52423 WP_000073195.1.52427 WP_000073195.1.52436 WP_000073195.1.52440 WP_000073195.1.52442 WP_000073195.1.52452 WP_000073195.1.52463 WP_000073195.1.52464 WP_000073195.1.52474 WP_000073195.1.5251 WP_000073195.1.52511 WP_000073195.1.52518 WP_000073195.1.52548 WP_000073195.1.52595 WP_000073195.1.52602 WP_000073195.1.52605 WP_000073195.1.52622 WP_000073195.1.52623 WP_000073195.1.52624 WP_000073195.1.52633 WP_000073195.1.52645 WP_000073195.1.52660 WP_000073195.1.52670 WP_000073195.1.52687 WP_000073195.1.52699 WP_000073195.1.52715 WP_000073195.1.52722 WP_000073195.1.52751 WP_000073195.1.52754 WP_000073195.1.52828 WP_000073195.1.52830 WP_000073195.1.52836 WP_000073195.1.52848 WP_000073195.1.52865 WP_000073195.1.52877 WP_000073195.1.52878 WP_000073195.1.52886 WP_000073195.1.52889 WP_000073195.1.52893 WP_000073195.1.52900 WP_000073195.1.52941 WP_000073195.1.52947 WP_000073195.1.52965 WP_000073195.1.52983 WP_000073195.1.52984 WP_000073195.1.52992 WP_000073195.1.53002 WP_000073195.1.53022 WP_000073195.1.5304 WP_000073195.1.53050 WP_000073195.1.53057 WP_000073195.1.53060 WP_000073195.1.53069 WP_000073195.1.53071 WP_000073195.1.53109 WP_000073195.1.53140 WP_000073195.1.53153 WP_000073195.1.53178 WP_000073195.1.53189 WP_000073195.1.5319 WP_000073195.1.53209 WP_000073195.1.5323 WP_000073195.1.53245 WP_000073195.1.53260 WP_000073195.1.53285 WP_000073195.1.53312 WP_000073195.1.53317 WP_000073195.1.53319 WP_000073195.1.53323 WP_000073195.1.53352 WP_000073195.1.5336 WP_000073195.1.53363 WP_000073195.1.53366 WP_000073195.1.53372 WP_000073195.1.53373 WP_000073195.1.53379 WP_000073195.1.53383 WP_000073195.1.53387 WP_000073195.1.53394 WP_000073195.1.53403 WP_000073195.1.53408 WP_000073195.1.53418 WP_000073195.1.53432 WP_000073195.1.53433 WP_000073195.1.53444 WP_000073195.1.53452 WP_000073195.1.53462 WP_000073195.1.53467 WP_000073195.1.5347 WP_000073195.1.53488 WP_000073195.1.53503 WP_000073195.1.53521 WP_000073195.1.53532 WP_000073195.1.53577 WP_000073195.1.5359 WP_000073195.1.53641 WP_000073195.1.53648 WP_000073195.1.53671 WP_000073195.1.53691 WP_000073195.1.53758 WP_000073195.1.53759 WP_000073195.1.53766 WP_000073195.1.53774 WP_000073195.1.53799 WP_000073195.1.5382 WP_000073195.1.53827 WP_000073195.1.53835 WP_000073195.1.53886 WP_000073195.1.53889 WP_000073195.1.53911 WP_000073195.1.53915 WP_000073195.1.53924 WP_000073195.1.53926 WP_000073195.1.53934 WP_000073195.1.53969 WP_000073195.1.53999 WP_000073195.1.5401 WP_000073195.1.54022 WP_000073195.1.54029 WP_000073195.1.54048 WP_000073195.1.54049 WP_000073195.1.54074 WP_000073195.1.54086 WP_000073195.1.54094 WP_000073195.1.54105 WP_000073195.1.54109 WP_000073195.1.54147 WP_000073195.1.54161 WP_000073195.1.54199 WP_000073195.1.54229 WP_000073195.1.54237 WP_000073195.1.54246 WP_000073195.1.54253 WP_000073195.1.54282 WP_000073195.1.54290 WP_000073195.1.54297 WP_000073195.1.54299 WP_000073195.1.54332 WP_000073195.1.54373 WP_000073195.1.54395 WP_000073195.1.544 WP_000073195.1.54404 WP_000073195.1.54413 WP_000073195.1.54426 WP_000073195.1.54438 WP_000073195.1.54446 WP_000073195.1.54471 WP_000073195.1.54479 WP_000073195.1.54485 WP_000073195.1.54491 WP_000073195.1.54503 WP_000073195.1.54510 WP_000073195.1.54518 WP_000073195.1.54539 WP_000073195.1.54543 WP_000073195.1.54551 WP_000073195.1.54572 WP_000073195.1.54574 WP_000073195.1.54637 WP_000073195.1.54675 WP_000073195.1.54689 WP_000073195.1.5469 WP_000073195.1.54728 WP_000073195.1.54733 WP_000073195.1.54744 WP_000073195.1.54745 WP_000073195.1.54753 WP_000073195.1.54819 WP_000073195.1.54826 WP_000073195.1.54830 WP_000073195.1.54851 WP_000073195.1.54878 WP_000073195.1.54895 WP_000073195.1.54929 WP_000073195.1.54931 WP_000073195.1.54955 WP_000073195.1.54967 WP_000073195.1.54990 WP_000073195.1.54995 WP_000073195.1.5500 WP_000073195.1.55004 WP_000073195.1.55014 WP_000073195.1.55058 WP_000073195.1.55082 WP_000073195.1.55084 WP_000073195.1.55095 WP_000073195.1.55100 WP_000073195.1.55139 WP_000073195.1.5518 WP_000073195.1.5519 WP_000073195.1.55192 WP_000073195.1.552 WP_000073195.1.55214 WP_000073195.1.55220 WP_000073195.1.55239 WP_000073195.1.55271 WP_000073195.1.55272 WP_000073195.1.55274 WP_000073195.1.55301 WP_000073195.1.55306 WP_000073195.1.55309 WP_000073195.1.55327 WP_000073195.1.55336 WP_000073195.1.55353 WP_000073195.1.55367 WP_000073195.1.55369 WP_000073195.1.55403 WP_000073195.1.55405 WP_000073195.1.55419 WP_000073195.1.55421 WP_000073195.1.55442 WP_000073195.1.55495 WP_000073195.1.5550 WP_000073195.1.55508 WP_000073195.1.55527 WP_000073195.1.55535 WP_000073195.1.55538 WP_000073195.1.5554 WP_000073195.1.55544 WP_000073195.1.55558 WP_000073195.1.5556 WP_000073195.1.55573 WP_000073195.1.55583 WP_000073195.1.5559 WP_000073195.1.55603 WP_000073195.1.5562 WP_000073195.1.55628 WP_000073195.1.55637 WP_000073195.1.55653 WP_000073195.1.55657 WP_000073195.1.557 WP_000073195.1.55717 WP_000073195.1.55719 WP_000073195.1.55724 WP_000073195.1.55728 WP_000073195.1.55746 WP_000073195.1.55784 WP_000073195.1.55786 WP_000073195.1.5580 WP_000073195.1.55818 WP_000073195.1.55831 WP_000073195.1.55835 WP_000073195.1.55845 WP_000073195.1.55867 WP_000073195.1.55874 WP_000073195.1.55886 WP_000073195.1.5589 WP_000073195.1.5590 WP_000073195.1.55904 WP_000073195.1.55916 WP_000073195.1.55933 WP_000073195.1.55949 WP_000073195.1.55953 WP_000073195.1.55955 WP_000073195.1.55960 WP_000073195.1.55985 WP_000073195.1.55991 WP_000073195.1.56000 WP_000073195.1.56003 WP_000073195.1.56025 WP_000073195.1.56039 WP_000073195.1.5604 WP_000073195.1.56048 WP_000073195.1.5606 WP_000073195.1.56064 WP_000073195.1.56078 WP_000073195.1.56098 WP_000073195.1.56106 WP_000073195.1.56135 WP_000073195.1.56159 WP_000073195.1.56200 WP_000073195.1.56214 WP_000073195.1.56220 WP_000073195.1.56225 WP_000073195.1.5623 WP_000073195.1.56237 WP_000073195.1.56239 WP_000073195.1.56265 WP_000073195.1.56281 WP_000073195.1.56306 WP_000073195.1.56332 WP_000073195.1.56333 WP_000073195.1.56343 WP_000073195.1.5635 WP_000073195.1.5637 WP_000073195.1.56377 WP_000073195.1.56387 WP_000073195.1.56400 WP_000073195.1.5644 WP_000073195.1.56444 WP_000073195.1.56453 WP_000073195.1.56464 WP_000073195.1.56482 WP_000073195.1.56496 WP_000073195.1.56527 WP_000073195.1.56530 WP_000073195.1.56542 WP_000073195.1.56558 WP_000073195.1.56570 WP_000073195.1.5658 WP_000073195.1.56584 WP_000073195.1.56598 WP_000073195.1.566 WP_000073195.1.56608 WP_000073195.1.56619 WP_000073195.1.56628 WP_000073195.1.56641 WP_000073195.1.5665 WP_000073195.1.56658 WP_000073195.1.5666 WP_000073195.1.56696 WP_000073195.1.56702 WP_000073195.1.56708 WP_000073195.1.56722 WP_000073195.1.56723 WP_000073195.1.56737 WP_000073195.1.5675 WP_000073195.1.56767 WP_000073195.1.5677 WP_000073195.1.56772 WP_000073195.1.56778 WP_000073195.1.56779 WP_000073195.1.56794 WP_000073195.1.56803 WP_000073195.1.56806 WP_000073195.1.56815 WP_000073195.1.56822 WP_000073195.1.56856 WP_000073195.1.5686 WP_000073195.1.56865 WP_000073195.1.56878 WP_000073195.1.569 WP_000073195.1.56903 WP_000073195.1.56931 WP_000073195.1.56966 WP_000073195.1.56967 WP_000073195.1.56975 WP_000073195.1.56986 WP_000073195.1.57015 WP_000073195.1.57024 WP_000073195.1.57047 WP_000073195.1.5705 WP_000073195.1.57073 WP_000073195.1.57075 WP_000073195.1.57080 WP_000073195.1.57081 WP_000073195.1.57097 WP_000073195.1.57102 WP_000073195.1.57109 WP_000073195.1.57115 WP_000073195.1.57141 WP_000073195.1.57170 WP_000073195.1.57175 WP_000073195.1.5718 WP_000073195.1.57190 WP_000073195.1.57196 WP_000073195.1.57214 WP_000073195.1.57223 WP_000073195.1.57265 WP_000073195.1.57309 WP_000073195.1.57316 WP_000073195.1.57330 WP_000073195.1.57338 WP_000073195.1.57370 WP_000073195.1.57376 WP_000073195.1.57389 WP_000073195.1.57427 WP_000073195.1.57445 WP_000073195.1.57448 WP_000073195.1.57459 WP_000073195.1.57481 WP_000073195.1.5749 WP_000073195.1.57507 WP_000073195.1.5752 WP_000073195.1.57577 WP_000073195.1.57593 WP_000073195.1.57594 WP_000073195.1.57614 WP_000073195.1.5763 WP_000073195.1.57650 WP_000073195.1.57665 WP_000073195.1.57670 WP_000073195.1.57682 WP_000073195.1.57692 WP_000073195.1.57693 WP_000073195.1.5770 WP_000073195.1.57701 WP_000073195.1.57718 WP_000073195.1.57720 WP_000073195.1.57723 WP_000073195.1.57727 WP_000073195.1.57730 WP_000073195.1.57734 WP_000073195.1.57745 WP_000073195.1.57754 WP_000073195.1.57761 WP_000073195.1.57770 WP_000073195.1.57783 WP_000073195.1.57808 WP_000073195.1.57819 WP_000073195.1.57837 WP_000073195.1.57840 WP_000073195.1.57844 WP_000073195.1.57861 WP_000073195.1.57875 WP_000073195.1.57878 WP_000073195.1.57883 WP_000073195.1.57888 WP_000073195.1.579 WP_000073195.1.5791 WP_000073195.1.57910 WP_000073195.1.57915 WP_000073195.1.57943 WP_000073195.1.57944 WP_000073195.1.57952 WP_000073195.1.57962 WP_000073195.1.57974 WP_000073195.1.5799 WP_000073195.1.58005 WP_000073195.1.58006 WP_000073195.1.58014 WP_000073195.1.58016 WP_000073195.1.58017 WP_000073195.1.58035 WP_000073195.1.58042 WP_000073195.1.58049 WP_000073195.1.58050 WP_000073195.1.58051 WP_000073195.1.58074 WP_000073195.1.58106 WP_000073195.1.58116 WP_000073195.1.58122 WP_000073195.1.58127 WP_000073195.1.58148 WP_000073195.1.58158 WP_000073195.1.5816 WP_000073195.1.5817 WP_000073195.1.58175 WP_000073195.1.58185 WP_000073195.1.58198 WP_000073195.1.58212 WP_000073195.1.58241 WP_000073195.1.58242 WP_000073195.1.58246 WP_000073195.1.58277 WP_000073195.1.58317 WP_000073195.1.5832 WP_000073195.1.58321 WP_000073195.1.58325 WP_000073195.1.58350 WP_000073195.1.58352 WP_000073195.1.58353 WP_000073195.1.58364 WP_000073195.1.58366 WP_000073195.1.58373 WP_000073195.1.58388 WP_000073195.1.58392 WP_000073195.1.58395 WP_000073195.1.58413 WP_000073195.1.58419 WP_000073195.1.58421 WP_000073195.1.58430 WP_000073195.1.58435 WP_000073195.1.58473 WP_000073195.1.58481 WP_000073195.1.5849 WP_000073195.1.58495 WP_000073195.1.58504 WP_000073195.1.58508 WP_000073195.1.58512 WP_000073195.1.58521 WP_000073195.1.58530 WP_000073195.1.58549 WP_000073195.1.5857 WP_000073195.1.58571 WP_000073195.1.58592 WP_000073195.1.58598 WP_000073195.1.586 WP_000073195.1.58603 WP_000073195.1.58626 WP_000073195.1.58686 WP_000073195.1.58701 WP_000073195.1.58704 WP_000073195.1.58714 WP_000073195.1.58718 WP_000073195.1.58735 WP_000073195.1.58760 WP_000073195.1.58763 WP_000073195.1.58772 WP_000073195.1.58775 WP_000073195.1.58798 WP_000073195.1.5880 WP_000073195.1.58833 WP_000073195.1.58839 WP_000073195.1.58855 WP_000073195.1.58934 WP_000073195.1.58960 WP_000073195.1.58981 WP_000073195.1.58991 WP_000073195.1.58998 WP_000073195.1.5901 WP_000073195.1.59011 WP_000073195.1.59014 WP_000073195.1.59039 WP_000073195.1.5904 WP_000073195.1.59046 WP_000073195.1.59062 WP_000073195.1.59077 WP_000073195.1.59098 WP_000073195.1.59124 WP_000073195.1.59133 WP_000073195.1.59135 WP_000073195.1.59146 WP_000073195.1.59157 WP_000073195.1.59175 WP_000073195.1.59187 WP_000073195.1.5920 WP_000073195.1.59203 WP_000073195.1.59213 WP_000073195.1.5925 WP_000073195.1.59269 WP_000073195.1.59284 WP_000073195.1.5930 WP_000073195.1.59311 WP_000073195.1.59327 WP_000073195.1.59329 WP_000073195.1.59337 WP_000073195.1.59363 WP_000073195.1.5938 WP_000073195.1.59380 WP_000073195.1.59397 WP_000073195.1.59398 WP_000073195.1.5940 WP_000073195.1.59401 WP_000073195.1.59404 WP_000073195.1.59441 WP_000073195.1.59457 WP_000073195.1.59459 WP_000073195.1.59462 WP_000073195.1.59464 WP_000073195.1.59467 WP_000073195.1.59478 WP_000073195.1.59489 WP_000073195.1.59498 WP_000073195.1.59540 WP_000073195.1.59546 WP_000073195.1.59567 WP_000073195.1.59598 WP_000073195.1.59603 WP_000073195.1.59609 WP_000073195.1.59624 WP_000073195.1.59629 WP_000073195.1.59643 WP_000073195.1.59663 WP_000073195.1.59668 WP_000073195.1.59669 WP_000073195.1.59671 WP_000073195.1.59697 WP_000073195.1.5972 WP_000073195.1.59736 WP_000073195.1.59787 WP_000073195.1.59803 WP_000073195.1.59810 WP_000073195.1.59819 WP_000073195.1.5982 WP_000073195.1.59822 WP_000073195.1.59874 WP_000073195.1.59881 WP_000073195.1.59886 WP_000073195.1.59896 WP_000073195.1.59907 WP_000073195.1.59915 WP_000073195.1.59921 WP_000073195.1.59945 WP_000073195.1.59977 WP_000073195.1.60001 WP_000073195.1.60006 WP_000073195.1.60022 WP_000073195.1.6006 WP_000073195.1.60086 WP_000073195.1.60101 WP_000073195.1.60107 WP_000073195.1.6011 WP_000073195.1.60123 WP_000073195.1.60124 WP_000073195.1.60147 WP_000073195.1.60149 WP_000073195.1.60156 WP_000073195.1.60157 WP_000073195.1.60165 WP_000073195.1.6017 WP_000073195.1.60181 WP_000073195.1.602 WP_000073195.1.60201 WP_000073195.1.60227 WP_000073195.1.60251 WP_000073195.1.60259 WP_000073195.1.60280 WP_000073195.1.60289 WP_000073195.1.60302 WP_000073195.1.60307 WP_000073195.1.6034 WP_000073195.1.60345 WP_000073195.1.60353 WP_000073195.1.60360 WP_000073195.1.60368 WP_000073195.1.60382 WP_000073195.1.60414 WP_000073195.1.60431 WP_000073195.1.60434 WP_000073195.1.6045 WP_000073195.1.60462 WP_000073195.1.60473 WP_000073195.1.60492 WP_000073195.1.60493 WP_000073195.1.60515 WP_000073195.1.60530 WP_000073195.1.60547 WP_000073195.1.60551 WP_000073195.1.60585 WP_000073195.1.60594 WP_000073195.1.60595 WP_000073195.1.60636 WP_000073195.1.60641 WP_000073195.1.60675 WP_000073195.1.60677 WP_000073195.1.60690 WP_000073195.1.60696 WP_000073195.1.60704 WP_000073195.1.60734 WP_000073195.1.60750 WP_000073195.1.60751 WP_000073195.1.60758 WP_000073195.1.60759 WP_000073195.1.60765 WP_000073195.1.60778 WP_000073195.1.60787 WP_000073195.1.60813 WP_000073195.1.60820 WP_000073195.1.60845 WP_000073195.1.6085 WP_000073195.1.60869 WP_000073195.1.60888 WP_000073195.1.60898 WP_000073195.1.60912 WP_000073195.1.60917 WP_000073195.1.60923 WP_000073195.1.60939 WP_000073195.1.60943 WP_000073195.1.60946 WP_000073195.1.60948 WP_000073195.1.60949 WP_000073195.1.60965 WP_000073195.1.60981 WP_000073195.1.60982 WP_000073195.1.60991 WP_000073195.1.61009 WP_000073195.1.61013 WP_000073195.1.61023 WP_000073195.1.61026 WP_000073195.1.61029 WP_000073195.1.61030 WP_000073195.1.61031 WP_000073195.1.61077 WP_000073195.1.61082 WP_000073195.1.61107 WP_000073195.1.61115 WP_000073195.1.61119 WP_000073195.1.61139 WP_000073195.1.61152 WP_000073195.1.61153 WP_000073195.1.6118 WP_000073195.1.61187 WP_000073195.1.61188 WP_000073195.1.61189 WP_000073195.1.6119 WP_000073195.1.61215 WP_000073195.1.61224 WP_000073195.1.6123 WP_000073195.1.61257 WP_000073195.1.61261 WP_000073195.1.61263 WP_000073195.1.61271 WP_000073195.1.61277 WP_000073195.1.61286 WP_000073195.1.61289 WP_000073195.1.61313 WP_000073195.1.61316 WP_000073195.1.61324 WP_000073195.1.61327 WP_000073195.1.61339 WP_000073195.1.6136 WP_000073195.1.61375 WP_000073195.1.61393 WP_000073195.1.61394 WP_000073195.1.61408 WP_000073195.1.61413 WP_000073195.1.61421 WP_000073195.1.61430 WP_000073195.1.61439 WP_000073195.1.61440 WP_000073195.1.61534 WP_000073195.1.61547 WP_000073195.1.61555 WP_000073195.1.61564 WP_000073195.1.61585 WP_000073195.1.61591 WP_000073195.1.61597 WP_000073195.1.61615 WP_000073195.1.61639 WP_000073195.1.61641 WP_000073195.1.6166 WP_000073195.1.6168 WP_000073195.1.61687 WP_000073195.1.61705 WP_000073195.1.61747 WP_000073195.1.61749 WP_000073195.1.61784 WP_000073195.1.61800 WP_000073195.1.61802 WP_000073195.1.61831 WP_000073195.1.61838 WP_000073195.1.61864 WP_000073195.1.6189 WP_000073195.1.61897 WP_000073195.1.61899 WP_000073195.1.619 WP_000073195.1.61903 WP_000073195.1.61910 WP_000073195.1.61921 WP_000073195.1.61936 WP_000073195.1.61970 WP_000073195.1.61975 WP_000073195.1.61978 WP_000073195.1.62002 WP_000073195.1.6201 WP_000073195.1.62028 WP_000073195.1.62030 WP_000073195.1.62069 WP_000073195.1.62071 WP_000073195.1.6208 WP_000073195.1.62084 WP_000073195.1.62088 WP_000073195.1.62093 WP_000073195.1.62096 WP_000073195.1.62140 WP_000073195.1.62160 WP_000073195.1.62164 WP_000073195.1.62229 WP_000073195.1.62247 WP_000073195.1.62253 WP_000073195.1.62254 WP_000073195.1.62265 WP_000073195.1.62318 WP_000073195.1.6234 WP_000073195.1.62346 WP_000073195.1.62352 WP_000073195.1.62367 WP_000073195.1.62382 WP_000073195.1.62383 WP_000073195.1.62398 WP_000073195.1.62409 WP_000073195.1.62414 WP_000073195.1.62416 WP_000073195.1.62429 WP_000073195.1.62437 WP_000073195.1.62453 WP_000073195.1.62459 WP_000073195.1.62474 WP_000073195.1.62482 WP_000073195.1.62492 WP_000073195.1.62496 WP_000073195.1.6250 WP_000073195.1.62537 WP_000073195.1.62539 WP_000073195.1.62553 WP_000073195.1.62575 WP_000073195.1.62602 WP_000073195.1.62608 WP_000073195.1.62621 WP_000073195.1.62625 WP_000073195.1.62630 WP_000073195.1.62653 WP_000073195.1.62671 WP_000073195.1.62674 WP_000073195.1.6268 WP_000073195.1.62684 WP_000073195.1.62685 WP_000073195.1.62723 WP_000073195.1.62740 WP_000073195.1.62756 WP_000073195.1.62764 WP_000073195.1.62771 WP_000073195.1.62781 WP_000073195.1.62796 WP_000073195.1.62808 WP_000073195.1.62822 WP_000073195.1.62824 WP_000073195.1.62829 WP_000073195.1.62831 WP_000073195.1.62842 WP_000073195.1.62860 WP_000073195.1.62863 WP_000073195.1.62878 WP_000073195.1.62880 WP_000073195.1.62927 WP_000073195.1.62956 WP_000073195.1.62970 WP_000073195.1.62974 WP_000073195.1.6298 WP_000073195.1.62998 WP_000073195.1.63003 WP_000073195.1.63004 WP_000073195.1.63011 WP_000073195.1.63027 WP_000073195.1.63040 WP_000073195.1.63047 WP_000073195.1.63050 WP_000073195.1.63051 WP_000073195.1.63052 WP_000073195.1.63062 WP_000073195.1.63068 WP_000073195.1.63070 WP_000073195.1.63083 WP_000073195.1.63085 WP_000073195.1.631 WP_000073195.1.63120 WP_000073195.1.63131 WP_000073195.1.63132 WP_000073195.1.63139 WP_000073195.1.63140 WP_000073195.1.63142 WP_000073195.1.63143 WP_000073195.1.63162 WP_000073195.1.63170 WP_000073195.1.63182 WP_000073195.1.63190 WP_000073195.1.63195 WP_000073195.1.63215 WP_000073195.1.63220 WP_000073195.1.63228 WP_000073195.1.63233 WP_000073195.1.63244 WP_000073195.1.63266 WP_000073195.1.63273 WP_000073195.1.63279 WP_000073195.1.63280 WP_000073195.1.63289 WP_000073195.1.63296 WP_000073195.1.63304 WP_000073195.1.63307 WP_000073195.1.63313 WP_000073195.1.63319 WP_000073195.1.63322 WP_000073195.1.63324 WP_000073195.1.63333 WP_000073195.1.63335 WP_000073195.1.63337 WP_000073195.1.63341 WP_000073195.1.63364 WP_000073195.1.63365 WP_000073195.1.63383 WP_000073195.1.634 WP_000073195.1.63406 WP_000073195.1.63411 WP_000073195.1.63421 WP_000073195.1.63441 WP_000073195.1.63460 WP_000073195.1.63469 WP_000073195.1.63471 WP_000073195.1.63510 WP_000073195.1.63527 WP_000073195.1.63565 WP_000073195.1.63589 WP_000073195.1.63617 WP_000073195.1.63635 WP_000073195.1.63673 WP_000073195.1.63678 WP_000073195.1.63693 WP_000073195.1.63705 WP_000073195.1.63726 WP_000073195.1.63729 WP_000073195.1.6374 WP_000073195.1.63751 WP_000073195.1.63759 WP_000073195.1.63760 WP_000073195.1.63774 WP_000073195.1.6378 WP_000073195.1.63828 WP_000073195.1.63847 WP_000073195.1.63874 WP_000073195.1.63878 WP_000073195.1.6388 WP_000073195.1.63894 WP_000073195.1.63895 WP_000073195.1.63907 WP_000073195.1.63910 WP_000073195.1.63923 WP_000073195.1.63937 WP_000073195.1.63947 WP_000073195.1.63975 WP_000073195.1.63978 WP_000073195.1.63987 WP_000073195.1.64012 WP_000073195.1.6403 WP_000073195.1.6408 WP_000073195.1.64094 WP_000073195.1.64105 WP_000073195.1.64108 WP_000073195.1.6412 WP_000073195.1.64127 WP_000073195.1.64192 WP_000073195.1.642 WP_000073195.1.64207 WP_000073195.1.64230 WP_000073195.1.64234 WP_000073195.1.64250 WP_000073195.1.64251 WP_000073195.1.64279 WP_000073195.1.64288 WP_000073195.1.64303 WP_000073195.1.64304 WP_000073195.1.64334 WP_000073195.1.64351 WP_000073195.1.64367 WP_000073195.1.64368 WP_000073195.1.6438 WP_000073195.1.64396 WP_000073195.1.64397 WP_000073195.1.64400 WP_000073195.1.64440 WP_000073195.1.64456 WP_000073195.1.64457 WP_000073195.1.64473 WP_000073195.1.64525 WP_000073195.1.64549 WP_000073195.1.64565 WP_000073195.1.64583 WP_000073195.1.6459 WP_000073195.1.64598 WP_000073195.1.6462 WP_000073195.1.64628 WP_000073195.1.64630 WP_000073195.1.64631 WP_000073195.1.64643 WP_000073195.1.64665 WP_000073195.1.64677 WP_000073195.1.64686 WP_000073195.1.64720 WP_000073195.1.64765 WP_000073195.1.6479 WP_000073195.1.64811 WP_000073195.1.64845 WP_000073195.1.64858 WP_000073195.1.64860 WP_000073195.1.64873 WP_000073195.1.64879 WP_000073195.1.6488 WP_000073195.1.64893 WP_000073195.1.64896 WP_000073195.1.64897 WP_000073195.1.64899 WP_000073195.1.64928 WP_000073195.1.64935 WP_000073195.1.64951 WP_000073195.1.64956 WP_000073195.1.64961 WP_000073195.1.64988 WP_000073195.1.64994 WP_000073195.1.64996 WP_000073195.1.64998 WP_000073195.1.65025 WP_000073195.1.65033 WP_000073195.1.65038 WP_000073195.1.65044 WP_000073195.1.65046 WP_000073195.1.65076 WP_000073195.1.65082 WP_000073195.1.65125 WP_000073195.1.65132 WP_000073195.1.65153 WP_000073195.1.65156 WP_000073195.1.65158 WP_000073195.1.65180 WP_000073195.1.65193 WP_000073195.1.65203 WP_000073195.1.65214 WP_000073195.1.65217 WP_000073195.1.65233 WP_000073195.1.65243 WP_000073195.1.65259 WP_000073195.1.65264 WP_000073195.1.6531 WP_000073195.1.65317 WP_000073195.1.65346 WP_000073195.1.65358 WP_000073195.1.65361 WP_000073195.1.65367 WP_000073195.1.65387 WP_000073195.1.65406 WP_000073195.1.65407 WP_000073195.1.65419 WP_000073195.1.65423 WP_000073195.1.65432 WP_000073195.1.6544 WP_000073195.1.65443 WP_000073195.1.65448 WP_000073195.1.65451 WP_000073195.1.6547 WP_000073195.1.65470 WP_000073195.1.65504 WP_000073195.1.6551 WP_000073195.1.65512 WP_000073195.1.65520 WP_000073195.1.65541 WP_000073195.1.65544 WP_000073195.1.65555 WP_000073195.1.65562 WP_000073195.1.65585 WP_000073195.1.6559 WP_000073195.1.65600 WP_000073195.1.65616 WP_000073195.1.65629 WP_000073195.1.65643 WP_000073195.1.65653 WP_000073195.1.65656 WP_000073195.1.65663 WP_000073195.1.65675 WP_000073195.1.6568 WP_000073195.1.65689 WP_000073195.1.65700 WP_000073195.1.65703 WP_000073195.1.65705 WP_000073195.1.65713 WP_000073195.1.65717 WP_000073195.1.65734 WP_000073195.1.65750 WP_000073195.1.65752 WP_000073195.1.65769 WP_000073195.1.65808 WP_000073195.1.65809 WP_000073195.1.65842 WP_000073195.1.6585 WP_000073195.1.65856 WP_000073195.1.65870 WP_000073195.1.65892 WP_000073195.1.65922 WP_000073195.1.65930 WP_000073195.1.65931 WP_000073195.1.65935 WP_000073195.1.65946 WP_000073195.1.65947 WP_000073195.1.65948 WP_000073195.1.65965 WP_000073195.1.65986 WP_000073195.1.66009 WP_000073195.1.6603 WP_000073195.1.66035 WP_000073195.1.66054 WP_000073195.1.66056 WP_000073195.1.66069 WP_000073195.1.66073 WP_000073195.1.66081 WP_000073195.1.661 WP_000073195.1.6612 WP_000073195.1.66120 WP_000073195.1.66130 WP_000073195.1.66133 WP_000073195.1.66144 WP_000073195.1.66175 WP_000073195.1.66262 WP_000073195.1.66265 WP_000073195.1.66281 WP_000073195.1.66298 WP_000073195.1.66302 WP_000073195.1.6632 WP_000073195.1.66322 WP_000073195.1.66366 WP_000073195.1.66369 WP_000073195.1.66433 WP_000073195.1.66453 WP_000073195.1.66482 WP_000073195.1.66505 WP_000073195.1.66513 WP_000073195.1.66519 WP_000073195.1.66542 WP_000073195.1.66554 WP_000073195.1.66556 WP_000073195.1.66564 WP_000073195.1.66576 WP_000073195.1.66588 WP_000073195.1.66598 WP_000073195.1.66601 WP_000073195.1.66606 WP_000073195.1.66611 WP_000073195.1.66614 WP_000073195.1.6662 WP_000073195.1.66628 WP_000073195.1.66655 WP_000073195.1.66664 WP_000073195.1.66677 WP_000073195.1.66705 WP_000073195.1.66711 WP_000073195.1.66712 WP_000073195.1.66726 WP_000073195.1.6674 WP_000073195.1.66756 WP_000073195.1.66765 WP_000073195.1.66766 WP_000073195.1.66786 WP_000073195.1.66803 WP_000073195.1.66816 WP_000073195.1.66818 WP_000073195.1.6684 WP_000073195.1.66879 WP_000073195.1.6688 WP_000073195.1.66904 WP_000073195.1.66938 WP_000073195.1.66969 WP_000073195.1.66979 WP_000073195.1.66996 WP_000073195.1.6700 WP_000073195.1.67006 WP_000073195.1.67012 WP_000073195.1.67014 WP_000073195.1.67067 WP_000073195.1.67072 WP_000073195.1.67090 WP_000073195.1.67112 WP_000073195.1.67113 WP_000073195.1.67135 WP_000073195.1.67147 WP_000073195.1.67155 WP_000073195.1.67160 WP_000073195.1.67191 WP_000073195.1.67204 WP_000073195.1.67212 WP_000073195.1.6722 WP_000073195.1.67238 WP_000073195.1.67251 WP_000073195.1.67259 WP_000073195.1.6726 WP_000073195.1.67266 WP_000073195.1.67286 WP_000073195.1.67294 WP_000073195.1.67296 WP_000073195.1.67297 WP_000073195.1.67312 WP_000073195.1.67328 WP_000073195.1.67329 WP_000073195.1.67333 WP_000073195.1.67379 WP_000073195.1.67384 WP_000073195.1.67386 WP_000073195.1.6740 WP_000073195.1.67414 WP_000073195.1.67418 WP_000073195.1.67420 WP_000073195.1.67425 WP_000073195.1.67447 WP_000073195.1.67457 WP_000073195.1.67460 WP_000073195.1.67463 WP_000073195.1.67480 WP_000073195.1.67505 WP_000073195.1.67507 WP_000073195.1.67513 WP_000073195.1.67520 WP_000073195.1.67521 WP_000073195.1.67540 WP_000073195.1.67554 WP_000073195.1.67571 WP_000073195.1.67572 WP_000073195.1.67609 WP_000073195.1.67612 WP_000073195.1.67618 WP_000073195.1.67621 WP_000073195.1.67632 WP_000073195.1.67644 WP_000073195.1.67651 WP_000073195.1.67652 WP_000073195.1.67691 WP_000073195.1.67703 WP_000073195.1.67712 WP_000073195.1.67713 WP_000073195.1.67722 WP_000073195.1.67752 WP_000073195.1.67754 WP_000073195.1.67762 WP_000073195.1.67767 WP_000073195.1.67806 WP_000073195.1.67815 WP_000073195.1.67834 WP_000073195.1.6786 WP_000073195.1.67864 WP_000073195.1.67865 WP_000073195.1.67867 WP_000073195.1.67880 WP_000073195.1.67889 WP_000073195.1.67900 WP_000073195.1.67925 WP_000073195.1.67941 WP_000073195.1.67986 WP_000073195.1.67991 WP_000073195.1.68001 WP_000073195.1.68033 WP_000073195.1.68054 WP_000073195.1.68066 WP_000073195.1.68101 WP_000073195.1.68102 WP_000073195.1.6811 WP_000073195.1.68111 WP_000073195.1.68134 WP_000073195.1.68139 WP_000073195.1.68141 WP_000073195.1.68152 WP_000073195.1.68160 WP_000073195.1.68161 WP_000073195.1.68199 WP_000073195.1.68202 WP_000073195.1.68219 WP_000073195.1.68221 WP_000073195.1.68223 WP_000073195.1.6824 WP_000073195.1.68261 WP_000073195.1.68268 WP_000073195.1.68286 WP_000073195.1.68295 WP_000073195.1.68296 WP_000073195.1.68299 WP_000073195.1.6830 WP_000073195.1.68307 WP_000073195.1.6834 WP_000073195.1.68343 WP_000073195.1.68351 WP_000073195.1.68355 WP_000073195.1.68366 WP_000073195.1.68367 WP_000073195.1.6839 WP_000073195.1.68397 WP_000073195.1.68398 WP_000073195.1.68399 WP_000073195.1.68404 WP_000073195.1.68416 WP_000073195.1.68425 WP_000073195.1.68466 WP_000073195.1.68479 WP_000073195.1.68483 WP_000073195.1.68489 WP_000073195.1.68504 WP_000073195.1.68505 WP_000073195.1.68512 WP_000073195.1.68522 WP_000073195.1.68542 WP_000073195.1.68548 WP_000073195.1.68565 WP_000073195.1.68575 WP_000073195.1.686 WP_000073195.1.68636 WP_000073195.1.68650 WP_000073195.1.68657 WP_000073195.1.68681 WP_000073195.1.68683 WP_000073195.1.68699 WP_000073195.1.68716 WP_000073195.1.68728 WP_000073195.1.68737 WP_000073195.1.68741 WP_000073195.1.68743 WP_000073195.1.68775 WP_000073195.1.68813 WP_000073195.1.68831 WP_000073195.1.68854 WP_000073195.1.68864 WP_000073195.1.68878 WP_000073195.1.68883 WP_000073195.1.68917 WP_000073195.1.68943 WP_000073195.1.68944 WP_000073195.1.68987 WP_000073195.1.68998 WP_000073195.1.69012 WP_000073195.1.69045 WP_000073195.1.69071 WP_000073195.1.69078 WP_000073195.1.69087 WP_000073195.1.69089 WP_000073195.1.691 WP_000073195.1.69105 WP_000073195.1.69110 WP_000073195.1.69111 WP_000073195.1.69120 WP_000073195.1.69125 WP_000073195.1.69147 WP_000073195.1.6915 WP_000073195.1.6917 WP_000073195.1.69179 WP_000073195.1.69191 WP_000073195.1.69198 WP_000073195.1.69213 WP_000073195.1.69219 WP_000073195.1.69222 WP_000073195.1.69232 WP_000073195.1.69237 WP_000073195.1.69239 WP_000073195.1.69251 WP_000073195.1.69266 WP_000073195.1.69280 WP_000073195.1.69314 WP_000073195.1.69349 WP_000073195.1.69361 WP_000073195.1.69366 WP_000073195.1.69378 WP_000073195.1.69394 WP_000073195.1.69395 WP_000073195.1.69409 WP_000073195.1.69415 WP_000073195.1.69434 WP_000073195.1.69437 WP_000073195.1.69446 WP_000073195.1.69475 WP_000073195.1.69476 WP_000073195.1.69477 WP_000073195.1.69480 WP_000073195.1.69484 WP_000073195.1.69490 WP_000073195.1.695 WP_000073195.1.6953 WP_000073195.1.69546 WP_000073195.1.69552 WP_000073195.1.69559 WP_000073195.1.69563 WP_000073195.1.69598 WP_000073195.1.69622 WP_000073195.1.69679 WP_000073195.1.6968 WP_000073195.1.69683 WP_000073195.1.69685 WP_000073195.1.69718 WP_000073195.1.69724 WP_000073195.1.69734 WP_000073195.1.6980 WP_000073195.1.69820 WP_000073195.1.69823 WP_000073195.1.69830 WP_000073195.1.69842 WP_000073195.1.69877 WP_000073195.1.69878 WP_000073195.1.69882 WP_000073195.1.699 WP_000073195.1.69902 WP_000073195.1.69921 WP_000073195.1.69934 WP_000073195.1.69980 WP_000073195.1.69987 WP_000073195.1.69995 WP_000073195.1.70024 WP_000073195.1.70048 WP_000073195.1.70059 WP_000073195.1.70089 WP_000073195.1.70105 WP_000073195.1.7012 WP_000073195.1.70133 WP_000073195.1.70161 WP_000073195.1.70210 WP_000073195.1.70220 WP_000073195.1.70225 WP_000073195.1.70228 WP_000073195.1.7024 WP_000073195.1.70253 WP_000073195.1.70273 WP_000073195.1.703 WP_000073195.1.7030 WP_000073195.1.70311 WP_000073195.1.70313 WP_000073195.1.70334 WP_000073195.1.70338 WP_000073195.1.7034 WP_000073195.1.70344 WP_000073195.1.70349 WP_000073195.1.70353 WP_000073195.1.70361 WP_000073195.1.70389 WP_000073195.1.70413 WP_000073195.1.7043 WP_000073195.1.70438 WP_000073195.1.70441 WP_000073195.1.70448 WP_000073195.1.70451 WP_000073195.1.70459 WP_000073195.1.7046 WP_000073195.1.70462 WP_000073195.1.70487 WP_000073195.1.70495 WP_000073195.1.70527 WP_000073195.1.7053 WP_000073195.1.70546 WP_000073195.1.70554 WP_000073195.1.70558 WP_000073195.1.70564 WP_000073195.1.70572 WP_000073195.1.706 WP_000073195.1.7061 WP_000073195.1.70611 WP_000073195.1.70635 WP_000073195.1.7064 WP_000073195.1.70641 WP_000073195.1.70651 WP_000073195.1.70664 WP_000073195.1.7067 WP_000073195.1.707 WP_000073195.1.7071 WP_000073195.1.70721 WP_000073195.1.7073 WP_000073195.1.70763 WP_000073195.1.70790 WP_000073195.1.70791 WP_000073195.1.70808 WP_000073195.1.70818 WP_000073195.1.70823 WP_000073195.1.70829 WP_000073195.1.70835 WP_000073195.1.70843 WP_000073195.1.70855 WP_000073195.1.7089 WP_000073195.1.70909 WP_000073195.1.70917 WP_000073195.1.70924 WP_000073195.1.70926 WP_000073195.1.70930 WP_000073195.1.70939 WP_000073195.1.70943 WP_000073195.1.710 WP_000073195.1.71016 WP_000073195.1.71043 WP_000073195.1.7105 WP_000073195.1.71058 WP_000073195.1.71059 WP_000073195.1.71073 WP_000073195.1.7109 WP_000073195.1.711 WP_000073195.1.71130 WP_000073195.1.71143 WP_000073195.1.71180 WP_000073195.1.71182 WP_000073195.1.7119 WP_000073195.1.71196 WP_000073195.1.7120 WP_000073195.1.71208 WP_000073195.1.71231 WP_000073195.1.7125 WP_000073195.1.71256 WP_000073195.1.71257 WP_000073195.1.71267 WP_000073195.1.71295 WP_000073195.1.71298 WP_000073195.1.71313 WP_000073195.1.71316 WP_000073195.1.71325 WP_000073195.1.71332 WP_000073195.1.71345 WP_000073195.1.71351 WP_000073195.1.71359 WP_000073195.1.71410 WP_000073195.1.71416 WP_000073195.1.71419 WP_000073195.1.71431 WP_000073195.1.71466 WP_000073195.1.71467 WP_000073195.1.71475 WP_000073195.1.7150 WP_000073195.1.71519 WP_000073195.1.71521 WP_000073195.1.71529 WP_000073195.1.71543 WP_000073195.1.71572 WP_000073195.1.71575 WP_000073195.1.7158 WP_000073195.1.71590 WP_000073195.1.71596 WP_000073195.1.71602 WP_000073195.1.7164 WP_000073195.1.71644 WP_000073195.1.71662 WP_000073195.1.71676 WP_000073195.1.71707 WP_000073195.1.71715 WP_000073195.1.71721 WP_000073195.1.71735 WP_000073195.1.71737 WP_000073195.1.71739 WP_000073195.1.71741 WP_000073195.1.71772 WP_000073195.1.71780 WP_000073195.1.71788 WP_000073195.1.7179 WP_000073195.1.71859 WP_000073195.1.71861 WP_000073195.1.71863 WP_000073195.1.71877 WP_000073195.1.71888 WP_000073195.1.71892 WP_000073195.1.71899 WP_000073195.1.71910 WP_000073195.1.71925 WP_000073195.1.7193 WP_000073195.1.71949 WP_000073195.1.71978 WP_000073195.1.7198 WP_000073195.1.71989 WP_000073195.1.72002 WP_000073195.1.72018 WP_000073195.1.72026 WP_000073195.1.72031 WP_000073195.1.72035 WP_000073195.1.72067 WP_000073195.1.72085 WP_000073195.1.72089 WP_000073195.1.72099 WP_000073195.1.72102 WP_000073195.1.72112 WP_000073195.1.72148 WP_000073195.1.72169 WP_000073195.1.72176 WP_000073195.1.722 WP_000073195.1.72204 WP_000073195.1.72205 WP_000073195.1.72224 WP_000073195.1.72271 WP_000073195.1.72285 WP_000073195.1.72306 WP_000073195.1.72315 WP_000073195.1.72340 WP_000073195.1.72347 WP_000073195.1.7236 WP_000073195.1.72363 WP_000073195.1.72371 WP_000073195.1.7242 WP_000073195.1.72424 WP_000073195.1.72433 WP_000073195.1.72446 WP_000073195.1.72453 WP_000073195.1.72465 WP_000073195.1.72478 WP_000073195.1.72496 WP_000073195.1.72497 WP_000073195.1.7254 WP_000073195.1.72547 WP_000073195.1.72564 WP_000073195.1.7258 WP_000073195.1.7260 WP_000073195.1.72626 WP_000073195.1.72649 WP_000073195.1.72654 WP_000073195.1.72666 WP_000073195.1.72708 WP_000073195.1.72719 WP_000073195.1.72750 WP_000073195.1.72753 WP_000073195.1.72762 WP_000073195.1.7278 WP_000073195.1.72787 WP_000073195.1.72816 WP_000073195.1.72832 WP_000073195.1.72834 WP_000073195.1.72835 WP_000073195.1.72881 WP_000073195.1.72903 WP_000073195.1.72904 WP_000073195.1.7292 WP_000073195.1.72930 WP_000073195.1.72935 WP_000073195.1.72945 WP_000073195.1.72961 WP_000073195.1.72965 WP_000073195.1.72991 WP_000073195.1.73002 WP_000073195.1.73004 WP_000073195.1.73017 WP_000073195.1.73019 WP_000073195.1.73021 WP_000073195.1.73022 WP_000073195.1.73037 WP_000073195.1.73046 WP_000073195.1.73074 WP_000073195.1.73087 WP_000073195.1.73121 WP_000073195.1.73122 WP_000073195.1.73132 WP_000073195.1.73140 WP_000073195.1.73190 WP_000073195.1.73191 WP_000073195.1.73195 WP_000073195.1.73201 WP_000073195.1.73211 WP_000073195.1.73240 WP_000073195.1.73241 WP_000073195.1.73246 WP_000073195.1.7326 WP_000073195.1.73264 WP_000073195.1.73265 WP_000073195.1.73286 WP_000073195.1.73312 WP_000073195.1.73386 WP_000073195.1.73401 WP_000073195.1.73420 WP_000073195.1.73444 WP_000073195.1.73450 WP_000073195.1.73456 WP_000073195.1.73464 WP_000073195.1.73467 WP_000073195.1.73501 WP_000073195.1.73513 WP_000073195.1.73526 WP_000073195.1.73539 WP_000073195.1.73571 WP_000073195.1.73591 WP_000073195.1.736 WP_000073195.1.7360 WP_000073195.1.73610 WP_000073195.1.73639 WP_000073195.1.73640 WP_000073195.1.7365 WP_000073195.1.73674 WP_000073195.1.73685 WP_000073195.1.73693 WP_000073195.1.73694 WP_000073195.1.73733 WP_000073195.1.73735 WP_000073195.1.73736 WP_000073195.1.73740 WP_000073195.1.73759 WP_000073195.1.73786 WP_000073195.1.73789 WP_000073195.1.7380 WP_000073195.1.73834 WP_000073195.1.73853 WP_000073195.1.73858 WP_000073195.1.73868 WP_000073195.1.73880 WP_000073195.1.73885 WP_000073195.1.73900 WP_000073195.1.73902 WP_000073195.1.73910 WP_000073195.1.73920 WP_000073195.1.73921 WP_000073195.1.73940 WP_000073195.1.73949 WP_000073195.1.73969 WP_000073195.1.73971 WP_000073195.1.73976 WP_000073195.1.73983 WP_000073195.1.74004 WP_000073195.1.74006 WP_000073195.1.7401 WP_000073195.1.74013 WP_000073195.1.74027 WP_000073195.1.7406 WP_000073195.1.74073 WP_000073195.1.74081 WP_000073195.1.74085 WP_000073195.1.74088 WP_000073195.1.74155 WP_000073195.1.74157 WP_000073195.1.74158 WP_000073195.1.74161 WP_000073195.1.74173 WP_000073195.1.7418 WP_000073195.1.74183 WP_000073195.1.74187 WP_000073195.1.74201 WP_000073195.1.74216 WP_000073195.1.74221 WP_000073195.1.74234 WP_000073195.1.74237 WP_000073195.1.74257 WP_000073195.1.7427 WP_000073195.1.74273 WP_000073195.1.7428 WP_000073195.1.74284 WP_000073195.1.74295 WP_000073195.1.74327 WP_000073195.1.74338 WP_000073195.1.7434 WP_000073195.1.74353 WP_000073195.1.74356 WP_000073195.1.74380 WP_000073195.1.74390 WP_000073195.1.74429 WP_000073195.1.74456 WP_000073195.1.74457 WP_000073195.1.74468 WP_000073195.1.74474 WP_000073195.1.74486 WP_000073195.1.74497 WP_000073195.1.74510 WP_000073195.1.74533 WP_000073195.1.74556 WP_000073195.1.7457 WP_000073195.1.74576 WP_000073195.1.74587 WP_000073195.1.74590 WP_000073195.1.74610 WP_000073195.1.74638 WP_000073195.1.74645 WP_000073195.1.74676 WP_000073195.1.74681 WP_000073195.1.74693 WP_000073195.1.74696 WP_000073195.1.74704 WP_000073195.1.74731 WP_000073195.1.74747 WP_000073195.1.74758 WP_000073195.1.74761 WP_000073195.1.74770 WP_000073195.1.74775 WP_000073195.1.74781 WP_000073195.1.74785 WP_000073195.1.74797 WP_000073195.1.74802 WP_000073195.1.74808 WP_000073195.1.7482 WP_000073195.1.74840 WP_000073195.1.74846 WP_000073195.1.74849 WP_000073195.1.74866 WP_000073195.1.74874 WP_000073195.1.74890 WP_000073195.1.74899 WP_000073195.1.74924 WP_000073195.1.74961 WP_000073195.1.74963 WP_000073195.1.74978 WP_000073195.1.74994 WP_000073195.1.74999 WP_000073195.1.7500 WP_000073195.1.75006 WP_000073195.1.75038 WP_000073195.1.75044 WP_000073195.1.75048 WP_000073195.1.75052 WP_000073195.1.75070 WP_000073195.1.75091 WP_000073195.1.75093 WP_000073195.1.75111 WP_000073195.1.75122 WP_000073195.1.75127 WP_000073195.1.75131 WP_000073195.1.75132 WP_000073195.1.75141 WP_000073195.1.75186 WP_000073195.1.75227 WP_000073195.1.75252 WP_000073195.1.75253 WP_000073195.1.75294 WP_000073195.1.75298 WP_000073195.1.75304 WP_000073195.1.75320 WP_000073195.1.75323 WP_000073195.1.75327 WP_000073195.1.75349 WP_000073195.1.75351 WP_000073195.1.75356 WP_000073195.1.75365 WP_000073195.1.75375 WP_000073195.1.75379 WP_000073195.1.75399 WP_000073195.1.75409 WP_000073195.1.75411 WP_000073195.1.7542 WP_000073195.1.75438 WP_000073195.1.75440 WP_000073195.1.75481 WP_000073195.1.75506 WP_000073195.1.75509 WP_000073195.1.75527 WP_000073195.1.75538 WP_000073195.1.75542 WP_000073195.1.75551 WP_000073195.1.75566 WP_000073195.1.75571 WP_000073195.1.7561 WP_000073195.1.75623 WP_000073195.1.75649 WP_000073195.1.75652 WP_000073195.1.75680 WP_000073195.1.75685 WP_000073195.1.75692 WP_000073195.1.75728 WP_000073195.1.75743 WP_000073195.1.75769 WP_000073195.1.75770 WP_000073195.1.75775 WP_000073195.1.758 WP_000073195.1.75800 WP_000073195.1.75809 WP_000073195.1.75824 WP_000073195.1.75830 WP_000073195.1.7584 WP_000073195.1.75840 WP_000073195.1.75848 WP_000073195.1.75851 WP_000073195.1.75856 WP_000073195.1.75862 WP_000073195.1.75879 WP_000073195.1.75881 WP_000073195.1.75885 WP_000073195.1.75910 WP_000073195.1.75929 WP_000073195.1.75952 WP_000073195.1.75956 WP_000073195.1.7596 WP_000073195.1.75969 WP_000073195.1.76010 WP_000073195.1.76013 WP_000073195.1.76015 WP_000073195.1.7602 WP_000073195.1.76047 WP_000073195.1.76049 WP_000073195.1.76050 WP_000073195.1.76053 WP_000073195.1.7607 WP_000073195.1.76071 WP_000073195.1.76073 WP_000073195.1.76095 WP_000073195.1.76111 WP_000073195.1.76112 WP_000073195.1.76114 WP_000073195.1.76121 WP_000073195.1.76136 WP_000073195.1.76143 WP_000073195.1.76149 WP_000073195.1.76153 WP_000073195.1.76179 WP_000073195.1.76185 WP_000073195.1.76230 WP_000073195.1.76234 WP_000073195.1.7624 WP_000073195.1.7625 WP_000073195.1.76258 WP_000073195.1.76261 WP_000073195.1.7627 WP_000073195.1.76282 WP_000073195.1.76283 WP_000073195.1.76294 WP_000073195.1.76295 WP_000073195.1.76313 WP_000073195.1.76323 WP_000073195.1.76332 WP_000073195.1.76333 WP_000073195.1.76337 WP_000073195.1.76351 WP_000073195.1.7638 WP_000073195.1.76411 WP_000073195.1.76419 WP_000073195.1.76420 WP_000073195.1.76421 WP_000073195.1.76424 WP_000073195.1.76426 WP_000073195.1.76431 WP_000073195.1.76463 WP_000073195.1.76482 WP_000073195.1.76497 WP_000073195.1.765 WP_000073195.1.76528 WP_000073195.1.7658 WP_000073195.1.76604 WP_000073195.1.76606 WP_000073195.1.76624 WP_000073195.1.76648 WP_000073195.1.76674 WP_000073195.1.76686 WP_000073195.1.76690 WP_000073195.1.76693 WP_000073195.1.76711 WP_000073195.1.76718 WP_000073195.1.7675 WP_000073195.1.76790 WP_000073195.1.76792 WP_000073195.1.76798 WP_000073195.1.768 WP_000073195.1.76803 WP_000073195.1.76816 WP_000073195.1.76820 WP_000073195.1.76825 WP_000073195.1.76829 WP_000073195.1.76839 WP_000073195.1.76845 WP_000073195.1.7686 WP_000073195.1.76867 WP_000073195.1.76872 WP_000073195.1.76876 WP_000073195.1.76878 WP_000073195.1.76897 WP_000073195.1.76920 WP_000073195.1.76921 WP_000073195.1.76937 WP_000073195.1.7694 WP_000073195.1.76944 WP_000073195.1.76952 WP_000073195.1.77013 WP_000073195.1.77020 WP_000073195.1.77027 WP_000073195.1.77031 WP_000073195.1.77041 WP_000073195.1.77043 WP_000073195.1.77050 WP_000073195.1.77060 WP_000073195.1.77062 WP_000073195.1.77069 WP_000073195.1.77072 WP_000073195.1.77112 WP_000073195.1.77137 WP_000073195.1.77145 WP_000073195.1.77158 WP_000073195.1.77176 WP_000073195.1.77183 WP_000073195.1.77187 WP_000073195.1.77190 WP_000073195.1.77203 WP_000073195.1.77229 WP_000073195.1.77256 WP_000073195.1.77259 WP_000073195.1.77297 WP_000073195.1.77298 WP_000073195.1.77305 WP_000073195.1.77315 WP_000073195.1.77331 WP_000073195.1.77346 WP_000073195.1.77354 WP_000073195.1.77359 WP_000073195.1.77388 WP_000073195.1.77416 WP_000073195.1.77426 WP_000073195.1.77446 WP_000073195.1.7745 WP_000073195.1.7746 WP_000073195.1.77460 WP_000073195.1.77485 WP_000073195.1.77489 WP_000073195.1.77497 WP_000073195.1.77498 WP_000073195.1.7752 WP_000073195.1.77520 WP_000073195.1.77527 WP_000073195.1.77532 WP_000073195.1.77533 WP_000073195.1.77536 WP_000073195.1.77572 WP_000073195.1.77603 WP_000073195.1.77606 WP_000073195.1.77650 WP_000073195.1.77674 WP_000073195.1.77733 WP_000073195.1.77735 WP_000073195.1.77738 WP_000073195.1.7774 WP_000073195.1.77743 WP_000073195.1.77745 WP_000073195.1.77763 WP_000073195.1.77791 WP_000073195.1.77805 WP_000073195.1.77814 WP_000073195.1.77818 WP_000073195.1.77822 WP_000073195.1.77827 WP_000073195.1.77832 WP_000073195.1.77848 WP_000073195.1.7785 WP_000073195.1.77858 WP_000073195.1.7786 WP_000073195.1.7787 WP_000073195.1.77882 WP_000073195.1.77893 WP_000073195.1.77896 WP_000073195.1.77908 WP_000073195.1.77915 WP_000073195.1.77922 WP_000073195.1.77930 WP_000073195.1.77952 WP_000073195.1.77957 WP_000073195.1.77986 WP_000073195.1.78002 WP_000073195.1.78038 WP_000073195.1.78050 WP_000073195.1.78054 WP_000073195.1.78067 WP_000073195.1.78082 WP_000073195.1.78091 WP_000073195.1.78093 WP_000073195.1.78095 WP_000073195.1.7810 WP_000073195.1.78116 WP_000073195.1.78126 WP_000073195.1.78164 WP_000073195.1.78173 WP_000073195.1.78179 WP_000073195.1.78185 WP_000073195.1.78189 WP_000073195.1.78194 WP_000073195.1.78207 WP_000073195.1.78208 WP_000073195.1.78210 WP_000073195.1.78252 WP_000073195.1.78254 WP_000073195.1.78257 WP_000073195.1.7827 WP_000073195.1.78304 WP_000073195.1.78311 WP_000073195.1.7833 WP_000073195.1.78330 WP_000073195.1.78332 WP_000073195.1.78335 WP_000073195.1.78365 WP_000073195.1.78371 WP_000073195.1.78392 WP_000073195.1.78404 WP_000073195.1.78434 WP_000073195.1.78436 WP_000073195.1.78458 WP_000073195.1.78470 WP_000073195.1.78478 WP_000073195.1.78489 WP_000073195.1.78494 WP_000073195.1.7850 WP_000073195.1.78513 WP_000073195.1.7853 WP_000073195.1.78550 WP_000073195.1.78558 WP_000073195.1.7857 WP_000073195.1.78573 WP_000073195.1.78582 WP_000073195.1.78585 WP_000073195.1.78592 WP_000073195.1.78596 WP_000073195.1.78598 WP_000073195.1.78604 WP_000073195.1.78625 WP_000073195.1.78633 WP_000073195.1.78653 WP_000073195.1.78662 WP_000073195.1.78667 WP_000073195.1.7868 WP_000073195.1.78685 WP_000073195.1.78708 WP_000073195.1.78728 WP_000073195.1.78731 WP_000073195.1.78736 WP_000073195.1.78758 WP_000073195.1.78763 WP_000073195.1.78803 WP_000073195.1.78816 WP_000073195.1.78819 WP_000073195.1.78841 WP_000073195.1.78872 WP_000073195.1.7888 WP_000073195.1.78897 WP_000073195.1.78920 WP_000073195.1.78934 WP_000073195.1.78937 WP_000073195.1.78946 WP_000073195.1.78983 WP_000073195.1.78985 WP_000073195.1.78991 WP_000073195.1.78995 WP_000073195.1.7900 WP_000073195.1.79006 WP_000073195.1.79037 WP_000073195.1.79038 WP_000073195.1.7905 WP_000073195.1.79051 WP_000073195.1.79085 WP_000073195.1.79110 WP_000073195.1.79114 WP_000073195.1.79131 WP_000073195.1.79132 WP_000073195.1.7914 WP_000073195.1.79143 WP_000073195.1.79170 WP_000073195.1.79178 WP_000073195.1.79192 WP_000073195.1.79197 WP_000073195.1.79208 WP_000073195.1.79223 WP_000073195.1.79227 WP_000073195.1.79270 WP_000073195.1.79275 WP_000073195.1.79285 WP_000073195.1.7930 WP_000073195.1.7931 WP_000073195.1.79310 WP_000073195.1.79314 WP_000073195.1.79320 WP_000073195.1.79322 WP_000073195.1.79332 WP_000073195.1.79334 WP_000073195.1.7934 WP_000073195.1.79341 WP_000073195.1.79367 WP_000073195.1.79374 WP_000073195.1.79378 WP_000073195.1.79379 WP_000073195.1.79402 WP_000073195.1.79407 WP_000073195.1.79408 WP_000073195.1.79436 WP_000073195.1.79461 WP_000073195.1.79473 WP_000073195.1.79476 WP_000073195.1.79487 WP_000073195.1.79539 WP_000073195.1.79543 WP_000073195.1.79552 WP_000073195.1.79554 WP_000073195.1.79556 WP_000073195.1.79566 WP_000073195.1.79581 WP_000073195.1.79626 WP_000073195.1.79627 WP_000073195.1.79638 WP_000073195.1.79646 WP_000073195.1.79662 WP_000073195.1.79664 WP_000073195.1.79672 WP_000073195.1.79676 WP_000073195.1.79677 WP_000073195.1.79706 WP_000073195.1.79731 WP_000073195.1.79763 WP_000073195.1.7981 WP_000073195.1.79810 WP_000073195.1.79815 WP_000073195.1.79822 WP_000073195.1.79831 WP_000073195.1.79834 WP_000073195.1.79837 WP_000073195.1.79855 WP_000073195.1.7989 WP_000073195.1.79896 WP_000073195.1.79904 WP_000073195.1.79911 WP_000073195.1.79919 WP_000073195.1.7992 WP_000073195.1.79941 WP_000073195.1.79949 WP_000073195.1.79961 WP_000073195.1.79971 WP_000073195.1.79991 WP_000073195.1.80000 WP_000073195.1.80009 WP_000073195.1.80013 WP_000073195.1.80029 WP_000073195.1.80032 WP_000073195.1.80034 WP_000073195.1.80042 WP_000073195.1.80079 WP_000073195.1.80086 WP_000073195.1.80109 WP_000073195.1.80119 WP_000073195.1.80120 WP_000073195.1.80122 WP_000073195.1.80124 WP_000073195.1.80127 WP_000073195.1.80146 WP_000073195.1.80147 WP_000073195.1.80159 WP_000073195.1.80178 WP_000073195.1.80184 WP_000073195.1.80193 WP_000073195.1.80203 WP_000073195.1.80206 WP_000073195.1.80210 WP_000073195.1.80244 WP_000073195.1.80274 WP_000073195.1.80287 WP_000073195.1.80290 WP_000073195.1.80297 WP_000073195.1.80303 WP_000073195.1.80308 WP_000073195.1.8031 WP_000073195.1.80316 WP_000073195.1.80318 WP_000073195.1.80345 WP_000073195.1.8035 WP_000073195.1.80358 WP_000073195.1.80361 WP_000073195.1.80378 WP_000073195.1.80389 WP_000073195.1.8040 WP_000073195.1.80407 WP_000073195.1.80414 WP_000073195.1.8043 WP_000073195.1.80430 WP_000073195.1.80434 WP_000073195.1.8045 WP_000073195.1.80472 WP_000073195.1.80482 WP_000073195.1.80521 WP_000073195.1.80530 WP_000073195.1.80582 WP_000073195.1.8065 WP_000073195.1.80653 WP_000073195.1.8066 WP_000073195.1.80680 WP_000073195.1.80687 WP_000073195.1.80717 WP_000073195.1.80745 WP_000073195.1.80761 WP_000073195.1.80763 WP_000073195.1.80786 WP_000073195.1.80793 WP_000073195.1.80801 WP_000073195.1.80828 WP_000073195.1.80833 WP_000073195.1.8084 WP_000073195.1.8085 WP_000073195.1.80855 WP_000073195.1.80872 WP_000073195.1.80899 WP_000073195.1.809 WP_000073195.1.80962 WP_000073195.1.80979 WP_000073195.1.80980 WP_000073195.1.81010 WP_000073195.1.81022 WP_000073195.1.81049 WP_000073195.1.81052 WP_000073195.1.81055 WP_000073195.1.81064 WP_000073195.1.81065 WP_000073195.1.81085 WP_000073195.1.81092 WP_000073195.1.81095 WP_000073195.1.81097 WP_000073195.1.81114 WP_000073195.1.81132 WP_000073195.1.81151 WP_000073195.1.81157 WP_000073195.1.81171 WP_000073195.1.81172 WP_000073195.1.81176 WP_000073195.1.81184 WP_000073195.1.81214 WP_000073195.1.81228 WP_000073195.1.81232 WP_000073195.1.81234 WP_000073195.1.8125 WP_000073195.1.81252 WP_000073195.1.81288 WP_000073195.1.81290 WP_000073195.1.81344 WP_000073195.1.8135 WP_000073195.1.81379 WP_000073195.1.81384 WP_000073195.1.81385 WP_000073195.1.81389 WP_000073195.1.8142 WP_000073195.1.81436 WP_000073195.1.8144 WP_000073195.1.81464 WP_000073195.1.81467 WP_000073195.1.81508 WP_000073195.1.81522 WP_000073195.1.81549 WP_000073195.1.81572 WP_000073195.1.81574 WP_000073195.1.81599 WP_000073195.1.8160 WP_000073195.1.81604 WP_000073195.1.81610 WP_000073195.1.81619 WP_000073195.1.81631 WP_000073195.1.81637 WP_000073195.1.81645 WP_000073195.1.81651 WP_000073195.1.81718 WP_000073195.1.81734 WP_000073195.1.81740 WP_000073195.1.81758 WP_000073195.1.8176 WP_000073195.1.81767 WP_000073195.1.8180 WP_000073195.1.81800 WP_000073195.1.81812 WP_000073195.1.81837 WP_000073195.1.81838 WP_000073195.1.81847 WP_000073195.1.8185 WP_000073195.1.81861 WP_000073195.1.81870 WP_000073195.1.8188 WP_000073195.1.81897 WP_000073195.1.81903 WP_000073195.1.81904 WP_000073195.1.81905 WP_000073195.1.81906 WP_000073195.1.81919 WP_000073195.1.81940 WP_000073195.1.81944 WP_000073195.1.81969 WP_000073195.1.81990 WP_000073195.1.81996 WP_000073195.1.81999 WP_000073195.1.82009 WP_000073195.1.82015 WP_000073195.1.82026 WP_000073195.1.82053 WP_000073195.1.82058 WP_000073195.1.8206 WP_000073195.1.82091 WP_000073195.1.82100 WP_000073195.1.8212 WP_000073195.1.82121 WP_000073195.1.8213 WP_000073195.1.82161 WP_000073195.1.82167 WP_000073195.1.82174 WP_000073195.1.82184 WP_000073195.1.82219 WP_000073195.1.82247 WP_000073195.1.82253 WP_000073195.1.82259 WP_000073195.1.82278 WP_000073195.1.82281 WP_000073195.1.82301 WP_000073195.1.82321 WP_000073195.1.82340 WP_000073195.1.82349 WP_000073195.1.82354 WP_000073195.1.82358 WP_000073195.1.82368 WP_000073195.1.82406 WP_000073195.1.8244 WP_000073195.1.82441 WP_000073195.1.82447 WP_000073195.1.82458 WP_000073195.1.8246 WP_000073195.1.82467 WP_000073195.1.82468 WP_000073195.1.82472 WP_000073195.1.82525 WP_000073195.1.82535 WP_000073195.1.82548 WP_000073195.1.82558 WP_000073195.1.82612 WP_000073195.1.8265 WP_000073195.1.8266 WP_000073195.1.82665 WP_000073195.1.82678 WP_000073195.1.82709 WP_000073195.1.82724 WP_000073195.1.82760 WP_000073195.1.82762 WP_000073195.1.82768 WP_000073195.1.82775 WP_000073195.1.82796 WP_000073195.1.8280 WP_000073195.1.82802 WP_000073195.1.82824 WP_000073195.1.82829 WP_000073195.1.82835 WP_000073195.1.82855 WP_000073195.1.82862 WP_000073195.1.8289 WP_000073195.1.82916 WP_000073195.1.82930 WP_000073195.1.82931 WP_000073195.1.82941 WP_000073195.1.82976 WP_000073195.1.82980 WP_000073195.1.82984 WP_000073195.1.82997 WP_000073195.1.82999 WP_000073195.1.83011 WP_000073195.1.83013 WP_000073195.1.83046 WP_000073195.1.83050 WP_000073195.1.83053 WP_000073195.1.83054 WP_000073195.1.83066 WP_000073195.1.83078 WP_000073195.1.83086 WP_000073195.1.83088 WP_000073195.1.8310 WP_000073195.1.83103 WP_000073195.1.83152 WP_000073195.1.83153 WP_000073195.1.8318 WP_000073195.1.83185 WP_000073195.1.83193 WP_000073195.1.83203 WP_000073195.1.83234 WP_000073195.1.83243 WP_000073195.1.83249 WP_000073195.1.8328 WP_000073195.1.83291 WP_000073195.1.83314 WP_000073195.1.83316 WP_000073195.1.83352 WP_000073195.1.83359 WP_000073195.1.83372 WP_000073195.1.83405 WP_000073195.1.83416 WP_000073195.1.83417 WP_000073195.1.83418 WP_000073195.1.8346 WP_000073195.1.83467 WP_000073195.1.83468 WP_000073195.1.83472 WP_000073195.1.83475 WP_000073195.1.83476 WP_000073195.1.83479 WP_000073195.1.83484 WP_000073195.1.83508 WP_000073195.1.83517 WP_000073195.1.83520 WP_000073195.1.83541 WP_000073195.1.83553 WP_000073195.1.83592 WP_000073195.1.83593 WP_000073195.1.83624 WP_000073195.1.83626 WP_000073195.1.83645 WP_000073195.1.83646 WP_000073195.1.83652 WP_000073195.1.83653 WP_000073195.1.8366 WP_000073195.1.83674 WP_000073195.1.83676 WP_000073195.1.83714 WP_000073195.1.83720 WP_000073195.1.83728 WP_000073195.1.83750 WP_000073195.1.83756 WP_000073195.1.83758 WP_000073195.1.83763 WP_000073195.1.83770 WP_000073195.1.83775 WP_000073195.1.83778 WP_000073195.1.83788 WP_000073195.1.83797 WP_000073195.1.83804 WP_000073195.1.83825 WP_000073195.1.8383 WP_000073195.1.83837 WP_000073195.1.83844 WP_000073195.1.8385 WP_000073195.1.83852 WP_000073195.1.83864 WP_000073195.1.83865 WP_000073195.1.83868 WP_000073195.1.83881 WP_000073195.1.83886 WP_000073195.1.83902 WP_000073195.1.83905 WP_000073195.1.83912 WP_000073195.1.83919 WP_000073195.1.83925 WP_000073195.1.83928 WP_000073195.1.83935 WP_000073195.1.83955 WP_000073195.1.83984 WP_000073195.1.83989 WP_000073195.1.84010 WP_000073195.1.84025 WP_000073195.1.84041 WP_000073195.1.84049 WP_000073195.1.84054 WP_000073195.1.84067 WP_000073195.1.84068 WP_000073195.1.84118 WP_000073195.1.84129 WP_000073195.1.84144 WP_000073195.1.84161 WP_000073195.1.84163 WP_000073195.1.84188 WP_000073195.1.84275 WP_000073195.1.84284 WP_000073195.1.84322 WP_000073195.1.84342 WP_000073195.1.84414 WP_000073195.1.84415 WP_000073195.1.84416 WP_000073195.1.84418 WP_000073195.1.84442 WP_000073195.1.84445 WP_000073195.1.84451 WP_000073195.1.84508 WP_000073195.1.84509 WP_000073195.1.84555 WP_000073195.1.84563 WP_000073195.1.84570 WP_000073195.1.84578 WP_000073195.1.84590 WP_000073195.1.84596 WP_000073195.1.84602 WP_000073195.1.84608 WP_000073195.1.84612 WP_000073195.1.8462 WP_000073195.1.84625 WP_000073195.1.84630 WP_000073195.1.84638 WP_000073195.1.84648 WP_000073195.1.84651 WP_000073195.1.84652 WP_000073195.1.84662 WP_000073195.1.8468 WP_000073195.1.84682 WP_000073195.1.84696 WP_000073195.1.84700 WP_000073195.1.8475 WP_000073195.1.84752 WP_000073195.1.84757 WP_000073195.1.84761 WP_000073195.1.84770 WP_000073195.1.84815 WP_000073195.1.84826 WP_000073195.1.84847 WP_000073195.1.84854 WP_000073195.1.84889 WP_000073195.1.84903 WP_000073195.1.84907 WP_000073195.1.84922 WP_000073195.1.84924 WP_000073195.1.8493 WP_000073195.1.84943 WP_000073195.1.8496 WP_000073195.1.84975 WP_000073195.1.84978 WP_000073195.1.85017 WP_000073195.1.85022 WP_000073195.1.85026 WP_000073195.1.85045 WP_000073195.1.85047 WP_000073195.1.85056 WP_000073195.1.85070 WP_000073195.1.85081 WP_000073195.1.85083 WP_000073195.1.85099 WP_000073195.1.851 WP_000073195.1.85118 WP_000073195.1.85132 WP_000073195.1.85135 WP_000073195.1.85144 WP_000073195.1.85151 WP_000073195.1.85160 WP_000073195.1.85173 WP_000073195.1.85213 WP_000073195.1.85224 WP_000073195.1.85226 WP_000073195.1.85229 WP_000073195.1.85231 WP_000073195.1.85235 WP_000073195.1.85238 WP_000073195.1.85289 WP_000073195.1.85292 WP_000073195.1.85294 WP_000073195.1.85297 WP_000073195.1.85302 WP_000073195.1.85351 WP_000073195.1.85374 WP_000073195.1.85375 WP_000073195.1.85376 WP_000073195.1.85383 WP_000073195.1.85395 WP_000073195.1.85404 WP_000073195.1.85409 WP_000073195.1.85440 WP_000073195.1.85441 WP_000073195.1.85445 WP_000073195.1.85455 WP_000073195.1.85462 WP_000073195.1.85471 WP_000073195.1.85474 WP_000073195.1.85485 WP_000073195.1.85492 WP_000073195.1.85506 WP_000073195.1.8551 WP_000073195.1.85515 WP_000073195.1.85519 WP_000073195.1.85542 WP_000073195.1.85547 WP_000073195.1.85555 WP_000073195.1.85585 WP_000073195.1.85586 WP_000073195.1.85596 WP_000073195.1.85607 WP_000073195.1.85611 WP_000073195.1.85649 WP_000073195.1.85678 WP_000073195.1.85705 WP_000073195.1.8572 WP_000073195.1.85730 WP_000073195.1.85732 WP_000073195.1.85758 WP_000073195.1.8576 WP_000073195.1.85795 WP_000073195.1.85796 WP_000073195.1.85809 WP_000073195.1.85816 WP_000073195.1.85825 WP_000073195.1.85834 WP_000073195.1.85844 WP_000073195.1.85858 WP_000073195.1.85873 WP_000073195.1.85924 WP_000073195.1.85927 WP_000073195.1.85950 WP_000073195.1.85971 WP_000073195.1.85980 WP_000073195.1.85989 WP_000073195.1.85993 WP_000073195.1.86018 WP_000073195.1.86036 WP_000073195.1.86042 WP_000073195.1.86072 WP_000073195.1.86086 WP_000073195.1.8609 WP_000073195.1.86101 WP_000073195.1.86106 WP_000073195.1.86123 WP_000073195.1.86144 WP_000073195.1.86154 WP_000073195.1.86158 WP_000073195.1.8617 WP_000073195.1.86178 WP_000073195.1.86188 WP_000073195.1.862 WP_000073195.1.86207 WP_000073195.1.86209 WP_000073195.1.86241 WP_000073195.1.86248 WP_000073195.1.86256 WP_000073195.1.8627 WP_000073195.1.86270 WP_000073195.1.86281 WP_000073195.1.86304 WP_000073195.1.86315 WP_000073195.1.86344 WP_000073195.1.8636 WP_000073195.1.86363 WP_000073195.1.86367 WP_000073195.1.86378 WP_000073195.1.86390 WP_000073195.1.8643 WP_000073195.1.86439 WP_000073195.1.86473 WP_000073195.1.86482 WP_000073195.1.86505 WP_000073195.1.86523 WP_000073195.1.86526 WP_000073195.1.86531 WP_000073195.1.86542 WP_000073195.1.86606 WP_000073195.1.86628 WP_000073195.1.86629 WP_000073195.1.86664 WP_000073195.1.86704 WP_000073195.1.86706 WP_000073195.1.86736 WP_000073195.1.86745 WP_000073195.1.86754 WP_000073195.1.86779 WP_000073195.1.86792 WP_000073195.1.86793 WP_000073195.1.86795 WP_000073195.1.8681 WP_000073195.1.86838 WP_000073195.1.86881 WP_000073195.1.8690 WP_000073195.1.86910 WP_000073195.1.86911 WP_000073195.1.86940 WP_000073195.1.86942 WP_000073195.1.86955 WP_000073195.1.86961 WP_000073195.1.86968 WP_000073195.1.86977 WP_000073195.1.8699 WP_000073195.1.86999 WP_000073195.1.87021 WP_000073195.1.87022 WP_000073195.1.87042 WP_000073195.1.87057 WP_000073195.1.87072 WP_000073195.1.87088 WP_000073195.1.87096 WP_000073195.1.87097 WP_000073195.1.87100 WP_000073195.1.87110 WP_000073195.1.87119 WP_000073195.1.8712 WP_000073195.1.87122 WP_000073195.1.87133 WP_000073195.1.87137 WP_000073195.1.87141 WP_000073195.1.87168 WP_000073195.1.87175 WP_000073195.1.87190 WP_000073195.1.87194 WP_000073195.1.8720 WP_000073195.1.87204 WP_000073195.1.87221 WP_000073195.1.87250 WP_000073195.1.87260 WP_000073195.1.87261 WP_000073195.1.87263 WP_000073195.1.87264 WP_000073195.1.87272 WP_000073195.1.87285 WP_000073195.1.87290 WP_000073195.1.87296 WP_000073195.1.8731 WP_000073195.1.87363 WP_000073195.1.87372 WP_000073195.1.87378 WP_000073195.1.87388 WP_000073195.1.87391 WP_000073195.1.87396 WP_000073195.1.87397 WP_000073195.1.87425 WP_000073195.1.87434 WP_000073195.1.87457 WP_000073195.1.87461 WP_000073195.1.87466 WP_000073195.1.87475 WP_000073195.1.87486 WP_000073195.1.87497 WP_000073195.1.87498 WP_000073195.1.875 WP_000073195.1.87502 WP_000073195.1.87508 WP_000073195.1.87511 WP_000073195.1.87515 WP_000073195.1.8753 WP_000073195.1.87541 WP_000073195.1.87543 WP_000073195.1.8757 WP_000073195.1.87579 WP_000073195.1.87595 WP_000073195.1.87601 WP_000073195.1.87623 WP_000073195.1.8764 WP_000073195.1.87647 WP_000073195.1.87703 WP_000073195.1.87710 WP_000073195.1.87718 WP_000073195.1.87734 WP_000073195.1.87735 WP_000073195.1.87740 WP_000073195.1.87745 WP_000073195.1.87748 WP_000073195.1.87764 WP_000073195.1.87782 WP_000073195.1.8779 WP_000073195.1.87802 WP_000073195.1.87808 WP_000073195.1.87828 WP_000073195.1.87838 WP_000073195.1.87841 WP_000073195.1.87843 WP_000073195.1.87854 WP_000073195.1.87865 WP_000073195.1.87879 WP_000073195.1.8791 WP_000073195.1.87912 WP_000073195.1.87937 WP_000073195.1.87943 WP_000073195.1.87948 WP_000073195.1.87963 WP_000073195.1.87964 WP_000073195.1.87967 WP_000073195.1.87972 WP_000073195.1.87985 WP_000073195.1.87995 WP_000073195.1.88013 WP_000073195.1.88032 WP_000073195.1.88061 WP_000073195.1.88101 WP_000073195.1.88114 WP_000073195.1.88150 WP_000073195.1.88166 WP_000073195.1.88169 WP_000073195.1.8820 WP_000073195.1.88240 WP_000073195.1.88270 WP_000073195.1.88279 WP_000073195.1.88309 WP_000073195.1.88311 WP_000073195.1.88317 WP_000073195.1.88319 WP_000073195.1.88328 WP_000073195.1.88348 WP_000073195.1.88351 WP_000073195.1.88367 WP_000073195.1.88371 WP_000073195.1.88373 WP_000073195.1.88375 WP_000073195.1.88380 WP_000073195.1.88395 WP_000073195.1.88418 WP_000073195.1.88430 WP_000073195.1.88440 WP_000073195.1.88449 WP_000073195.1.88455 WP_000073195.1.8847 WP_000073195.1.88471 WP_000073195.1.88473 WP_000073195.1.88478 WP_000073195.1.88480 WP_000073195.1.88490 WP_000073195.1.88498 WP_000073195.1.88518 WP_000073195.1.88555 WP_000073195.1.88558 WP_000073195.1.88560 WP_000073195.1.88563 WP_000073195.1.8857 WP_000073195.1.88580 WP_000073195.1.88583 WP_000073195.1.88585 WP_000073195.1.8859 WP_000073195.1.88599 WP_000073195.1.88600 WP_000073195.1.88614 WP_000073195.1.88623 WP_000073195.1.88636 WP_000073195.1.88642 WP_000073195.1.88671 WP_000073195.1.88694 WP_000073195.1.88696 WP_000073195.1.8872 WP_000073195.1.88738 WP_000073195.1.88739 WP_000073195.1.88753 WP_000073195.1.88761 WP_000073195.1.88771 WP_000073195.1.88781 WP_000073195.1.88805 WP_000073195.1.88827 WP_000073195.1.88843 WP_000073195.1.88856 WP_000073195.1.88859 WP_000073195.1.8886 WP_000073195.1.88861 WP_000073195.1.88874 WP_000073195.1.88878 WP_000073195.1.8888 WP_000073195.1.88897 WP_000073195.1.88912 WP_000073195.1.88922 WP_000073195.1.88934 WP_000073195.1.88954 WP_000073195.1.88959 WP_000073195.1.88960 WP_000073195.1.88962 WP_000073195.1.88987 WP_000073195.1.8899 WP_000073195.1.8900 WP_000073195.1.89012 WP_000073195.1.89024 WP_000073195.1.89036 WP_000073195.1.8904 WP_000073195.1.89070 WP_000073195.1.89086 WP_000073195.1.89103 WP_000073195.1.89125 WP_000073195.1.8913 WP_000073195.1.89133 WP_000073195.1.89164 WP_000073195.1.89173 WP_000073195.1.8918 WP_000073195.1.89181 WP_000073195.1.89184 WP_000073195.1.89194 WP_000073195.1.89195 WP_000073195.1.89204 WP_000073195.1.89229 WP_000073195.1.89235 WP_000073195.1.89237 WP_000073195.1.8924 WP_000073195.1.89258 WP_000073195.1.89262 WP_000073195.1.89284 WP_000073195.1.89290 WP_000073195.1.89347 WP_000073195.1.89348 WP_000073195.1.89350 WP_000073195.1.89390 WP_000073195.1.89404 WP_000073195.1.89414 WP_000073195.1.89433 WP_000073195.1.89439 WP_000073195.1.89516 WP_000073195.1.8953 WP_000073195.1.89537 WP_000073195.1.89544 WP_000073195.1.89545 WP_000073195.1.89559 WP_000073195.1.89628 WP_000073195.1.89651 WP_000073195.1.89655 WP_000073195.1.89672 WP_000073195.1.89678 WP_000073195.1.897 WP_000073195.1.89715 WP_000073195.1.89726 WP_000073195.1.89730 WP_000073195.1.89738 WP_000073195.1.89754 WP_000073195.1.89779 WP_000073195.1.89794 WP_000073195.1.898 WP_000073195.1.89857 WP_000073195.1.8986 WP_000073195.1.89860 WP_000073195.1.89863 WP_000073195.1.89874 WP_000073195.1.89883 WP_000073195.1.8990 WP_000073195.1.89908 WP_000073195.1.89933 WP_000073195.1.89935 WP_000073195.1.89949 WP_000073195.1.89950 WP_000073195.1.89960 WP_000073195.1.90005 WP_000073195.1.90018 WP_000073195.1.90038 WP_000073195.1.90046 WP_000073195.1.90055 WP_000073195.1.90069 WP_000073195.1.90091 WP_000073195.1.90112 WP_000073195.1.90131 WP_000073195.1.90148 WP_000073195.1.90161 WP_000073195.1.90173 WP_000073195.1.90174 WP_000073195.1.90180 WP_000073195.1.90215 WP_000073195.1.90217 WP_000073195.1.9022 WP_000073195.1.90232 WP_000073195.1.90239 WP_000073195.1.90243 WP_000073195.1.90244 WP_000073195.1.90246 WP_000073195.1.90250 WP_000073195.1.90253 WP_000073195.1.90269 WP_000073195.1.90276 WP_000073195.1.9030 WP_000073195.1.90307 WP_000073195.1.90331 WP_000073195.1.90367 WP_000073195.1.90386 WP_000073195.1.90432 WP_000073195.1.90447 WP_000073195.1.90454 WP_000073195.1.90473 WP_000073195.1.90475 WP_000073195.1.90488 WP_000073195.1.90506 WP_000073195.1.90514 WP_000073195.1.90517 WP_000073195.1.90533 WP_000073195.1.90544 WP_000073195.1.90548 WP_000073195.1.9055 WP_000073195.1.90554 WP_000073195.1.90556 WP_000073195.1.90562 WP_000073195.1.90604 WP_000073195.1.90647 WP_000073195.1.90660 WP_000073195.1.90661 WP_000073195.1.90683 WP_000073195.1.90698 WP_000073195.1.9071 WP_000073195.1.90717 WP_000073195.1.90726 WP_000073195.1.90728 WP_000073195.1.90738 WP_000073195.1.9074 WP_000073195.1.90745 WP_000073195.1.9076 WP_000073195.1.90777 WP_000073195.1.90801 WP_000073195.1.90804 WP_000073195.1.90818 WP_000073195.1.90861 WP_000073195.1.90875 WP_000073195.1.90887 WP_000073195.1.90896 WP_000073195.1.90903 WP_000073195.1.90923 WP_000073195.1.90928 WP_000073195.1.90994 WP_000073195.1.9100 WP_000073195.1.91005 WP_000073195.1.91011 WP_000073195.1.91019 WP_000073195.1.91054 WP_000073195.1.91087 WP_000073195.1.91089 WP_000073195.1.91124 WP_000073195.1.91126 WP_000073195.1.9114 WP_000073195.1.91150 WP_000073195.1.91158 WP_000073195.1.91177 WP_000073195.1.91184 WP_000073195.1.912 WP_000073195.1.9122 WP_000073195.1.91233 WP_000073195.1.91246 WP_000073195.1.91252 WP_000073195.1.91258 WP_000073195.1.9127 WP_000073195.1.91279 WP_000073195.1.91280 WP_000073195.1.91287 WP_000073195.1.9130 WP_000073195.1.91300 WP_000073195.1.91310 WP_000073195.1.91316 WP_000073195.1.91332 WP_000073195.1.91346 WP_000073195.1.91357 WP_000073195.1.91364 WP_000073195.1.91365 WP_000073195.1.91371 WP_000073195.1.91380 WP_000073195.1.91382 WP_000073195.1.9140 WP_000073195.1.91420 WP_000073195.1.91427 WP_000073195.1.91447 WP_000073195.1.91465 WP_000073195.1.91486 WP_000073195.1.91487 WP_000073195.1.91500 WP_000073195.1.91501 WP_000073195.1.91525 WP_000073195.1.91530 WP_000073195.1.91542 WP_000073195.1.91547 WP_000073195.1.9155 WP_000073195.1.91559 WP_000073195.1.91573 WP_000073195.1.91581 WP_000073195.1.91586 WP_000073195.1.91587 WP_000073195.1.91591 WP_000073195.1.91611 WP_000073195.1.91629 WP_000073195.1.91634 WP_000073195.1.91635 WP_000073195.1.91639 WP_000073195.1.91670 WP_000073195.1.917 WP_000073195.1.91704 WP_000073195.1.91745 WP_000073195.1.91749 WP_000073195.1.91771 WP_000073195.1.91781 WP_000073195.1.91791 WP_000073195.1.91800 WP_000073195.1.91816 WP_000073195.1.91829 WP_000073195.1.91848 WP_000073195.1.91895 WP_000073195.1.91911 WP_000073195.1.91918 WP_000073195.1.91928 WP_000073195.1.91950 WP_000073195.1.91955 WP_000073195.1.91969 WP_000073195.1.92 WP_000073195.1.92055 WP_000073195.1.92057 WP_000073195.1.92080 WP_000073195.1.92104 WP_000073195.1.92110 WP_000073195.1.92115 WP_000073195.1.92125 WP_000073195.1.92140 WP_000073195.1.92143 WP_000073195.1.92158 WP_000073195.1.92164 WP_000073195.1.92169 WP_000073195.1.92173 WP_000073195.1.92185 WP_000073195.1.92186 WP_000073195.1.92196 WP_000073195.1.92212 WP_000073195.1.92218 WP_000073195.1.92227 WP_000073195.1.92228 WP_000073195.1.9224 WP_000073195.1.92244 WP_000073195.1.92249 WP_000073195.1.92253 WP_000073195.1.92254 WP_000073195.1.92259 WP_000073195.1.92278 WP_000073195.1.92297 WP_000073195.1.923 WP_000073195.1.92303 WP_000073195.1.92324 WP_000073195.1.9234 WP_000073195.1.92340 WP_000073195.1.9239 WP_000073195.1.92391 WP_000073195.1.92398 WP_000073195.1.92405 WP_000073195.1.92415 WP_000073195.1.92424 WP_000073195.1.92425 WP_000073195.1.92436 WP_000073195.1.92442 WP_000073195.1.9247 WP_000073195.1.92479 WP_000073195.1.92488 WP_000073195.1.92497 WP_000073195.1.92500 WP_000073195.1.92512 WP_000073195.1.92520 WP_000073195.1.92534 WP_000073195.1.92541 WP_000073195.1.92544 WP_000073195.1.92560 WP_000073195.1.92565 WP_000073195.1.92602 WP_000073195.1.92607 WP_000073195.1.92667 WP_000073195.1.92674 WP_000073195.1.92679 WP_000073195.1.92691 WP_000073195.1.92718 WP_000073195.1.92723 WP_000073195.1.92726 WP_000073195.1.92735 WP_000073195.1.92741 WP_000073195.1.92765 WP_000073195.1.92772 WP_000073195.1.92773 WP_000073195.1.92778 WP_000073195.1.92789 WP_000073195.1.92795 WP_000073195.1.92805 WP_000073195.1.92840 WP_000073195.1.92849 WP_000073195.1.9286 WP_000073195.1.92862 WP_000073195.1.92897 WP_000073195.1.92918 WP_000073195.1.9293 WP_000073195.1.92937 WP_000073195.1.92950 WP_000073195.1.9296 WP_000073195.1.92960 WP_000073195.1.92965 WP_000073195.1.9298 WP_000073195.1.92997 WP_000073195.1.93010 WP_000073195.1.93041 WP_000073195.1.93047 WP_000073195.1.9305 WP_000073195.1.93068 WP_000073195.1.93071 WP_000073195.1.93074 WP_000073195.1.93078 WP_000073195.1.93125 WP_000073195.1.93141 WP_000073195.1.93147 WP_000073195.1.93163 WP_000073195.1.93176 WP_000073195.1.93186 WP_000073195.1.93191 WP_000073195.1.93197 WP_000073195.1.93207 WP_000073195.1.93211 WP_000073195.1.93224 WP_000073195.1.93231 WP_000073195.1.93235 WP_000073195.1.93237 WP_000073195.1.93243 WP_000073195.1.93251 WP_000073195.1.93254 WP_000073195.1.93260 WP_000073195.1.93272 WP_000073195.1.93296 WP_000073195.1.93300 WP_000073195.1.93310 WP_000073195.1.93316 WP_000073195.1.93329 WP_000073195.1.93336 WP_000073195.1.93354 WP_000073195.1.93378 WP_000073195.1.93416 WP_000073195.1.93435 WP_000073195.1.93438 WP_000073195.1.93444 WP_000073195.1.9346 WP_000073195.1.93471 WP_000073195.1.93492 WP_000073195.1.93514 WP_000073195.1.9352 WP_000073195.1.9354 WP_000073195.1.93561 WP_000073195.1.93567 WP_000073195.1.93579 WP_000073195.1.9358 WP_000073195.1.93590 WP_000073195.1.93613 WP_000073195.1.93658 WP_000073195.1.93678 WP_000073195.1.93690 WP_000073195.1.93708 WP_000073195.1.93710 WP_000073195.1.93722 WP_000073195.1.93736 WP_000073195.1.93738 WP_000073195.1.93758 WP_000073195.1.93762 WP_000073195.1.93769 WP_000073195.1.93775 WP_000073195.1.93787 WP_000073195.1.93862 WP_000073195.1.9387 WP_000073195.1.93882 WP_000073195.1.93883 WP_000073195.1.93890 WP_000073195.1.93891 WP_000073195.1.9392 WP_000073195.1.93934 WP_000073195.1.93972 WP_000073195.1.93976 WP_000073195.1.93981 WP_000073195.1.94 WP_000073195.1.94009 WP_000073195.1.94016 WP_000073195.1.94053 WP_000073195.1.94060 WP_000073195.1.94074 WP_000073195.1.9408 WP_000073195.1.94080 WP_000073195.1.94082 WP_000073195.1.94087 WP_000073195.1.9411 WP_000073195.1.94114 WP_000073195.1.94119 WP_000073195.1.94122 WP_000073195.1.94123 WP_000073195.1.94130 WP_000073195.1.94165 WP_000073195.1.94172 WP_000073195.1.94209 WP_000073195.1.94242 WP_000073195.1.94245 WP_000073195.1.94248 WP_000073195.1.94268 WP_000073195.1.94287 WP_000073195.1.94293 WP_000073195.1.94294 WP_000073195.1.9430 WP_000073195.1.94319 WP_000073195.1.94320 WP_000073195.1.94324 WP_000073195.1.94325 WP_000073195.1.94335 WP_000073195.1.94337 WP_000073195.1.94340 WP_000073195.1.94341 WP_000073195.1.94345 WP_000073195.1.9435 WP_000073195.1.9437 WP_000073195.1.94374 WP_000073195.1.94375 WP_000073195.1.94376 WP_000073195.1.94389 WP_000073195.1.94409 WP_000073195.1.94423 WP_000073195.1.94484 WP_000073195.1.94505 WP_000073195.1.94530 WP_000073195.1.94536 WP_000073195.1.94549 WP_000073195.1.9455 WP_000073195.1.94550 WP_000073195.1.94576 WP_000073195.1.94636 WP_000073195.1.9464 WP_000073195.1.94641 WP_000073195.1.94684 WP_000073195.1.94688 WP_000073195.1.947 WP_000073195.1.94733 WP_000073195.1.94741 WP_000073195.1.94789 WP_000073195.1.94797 WP_000073195.1.94825 WP_000073195.1.94844 WP_000073195.1.94845 WP_000073195.1.9485 WP_000073195.1.94857 WP_000073195.1.94866 WP_000073195.1.94941 WP_000073195.1.9495 WP_000073195.1.94958 WP_000073195.1.94969 WP_000073195.1.9497 WP_000073195.1.94980 WP_000073195.1.94989 WP_000073195.1.94992 WP_000073195.1.94999 WP_000073195.1.95008 WP_000073195.1.95014 WP_000073195.1.95023 WP_000073195.1.95029 WP_000073195.1.95033 WP_000073195.1.95038 WP_000073195.1.95049 WP_000073195.1.95075 WP_000073195.1.95077 WP_000073195.1.95090 WP_000073195.1.9510 WP_000073195.1.95120 WP_000073195.1.95154 WP_000073195.1.95156 WP_000073195.1.95174 WP_000073195.1.95193 WP_000073195.1.95210 WP_000073195.1.95263 WP_000073195.1.95281 WP_000073195.1.95294 WP_000073195.1.95304 WP_000073195.1.95307 WP_000073195.1.95318 WP_000073195.1.95327 WP_000073195.1.95342 WP_000073195.1.95361 WP_000073195.1.95372 WP_000073195.1.9538 WP_000073195.1.95386 WP_000073195.1.95409 WP_000073195.1.95415 WP_000073195.1.9544 WP_000073195.1.95452 WP_000073195.1.95476 WP_000073195.1.95494 WP_000073195.1.95495 WP_000073195.1.95500 WP_000073195.1.95505 WP_000073195.1.95512 WP_000073195.1.95519 WP_000073195.1.95522 WP_000073195.1.95537 WP_000073195.1.95545 WP_000073195.1.95550 WP_000073195.1.95560 WP_000073195.1.9557 WP_000073195.1.95571 WP_000073195.1.95581 WP_000073195.1.95603 WP_000073195.1.9563 WP_000073195.1.95639 WP_000073195.1.95681 WP_000073195.1.95683 WP_000073195.1.95699 WP_000073195.1.95704 WP_000073195.1.95713 WP_000073195.1.95714 WP_000073195.1.95737 WP_000073195.1.95760 WP_000073195.1.95780 WP_000073195.1.95781 WP_000073195.1.95804 WP_000073195.1.95806 WP_000073195.1.95832 WP_000073195.1.95877 WP_000073195.1.95885 WP_000073195.1.959 WP_000073195.1.95914 WP_000073195.1.95918 WP_000073195.1.95947 WP_000073195.1.95954 WP_000073195.1.95962 WP_000073195.1.95983 WP_000073195.1.95986 WP_000073195.1.95997 WP_000073195.1.96014 WP_000073195.1.96022 WP_000073195.1.96030 WP_000073195.1.96056 WP_000073195.1.96057 WP_000073195.1.96067 WP_000073195.1.96075 WP_000073195.1.96133 WP_000073195.1.96135 WP_000073195.1.96148 WP_000073195.1.96160 WP_000073195.1.96163 WP_000073195.1.96165 WP_000073195.1.96200 WP_000073195.1.96209 WP_000073195.1.96218 WP_000073195.1.96221 WP_000073195.1.96228 WP_000073195.1.96255 WP_000073195.1.96261 WP_000073195.1.96271 WP_000073195.1.96280 WP_000073195.1.96283 WP_000073195.1.96297 WP_000073195.1.96301 WP_000073195.1.96305 WP_000073195.1.96312 WP_000073195.1.96314 WP_000073195.1.96316 WP_000073195.1.96322 WP_000073195.1.96334 WP_000073195.1.96362 WP_000073195.1.96368 WP_000073195.1.96412 WP_000073195.1.96433 WP_000073195.1.96468 WP_000073195.1.96472 WP_000073195.1.96474 WP_000073195.1.96495 WP_000073195.1.9650 WP_000073195.1.96509 WP_000073195.1.96535 WP_000073195.1.96538 WP_000073195.1.96548 WP_000073195.1.96550 WP_000073195.1.96554 WP_000073195.1.96566 WP_000073195.1.96568 WP_000073195.1.96577 WP_000073195.1.96591 WP_000073195.1.96603 WP_000073195.1.96613 WP_000073195.1.96628 WP_000073195.1.96634 WP_000073195.1.96646 WP_000073195.1.96654 WP_000073195.1.96663 WP_000073195.1.96678 WP_000073195.1.96682 WP_000073195.1.96688 WP_000073195.1.96699 WP_000073195.1.96705 WP_000073195.1.96727 WP_000073195.1.9675 WP_000073195.1.96770 WP_000073195.1.96780 WP_000073195.1.96804 WP_000073195.1.96836 WP_000073195.1.9684 WP_000073195.1.96854 WP_000073195.1.96855 WP_000073195.1.96856 WP_000073195.1.96859 WP_000073195.1.96866 WP_000073195.1.96882 WP_000073195.1.96892 WP_000073195.1.96895 WP_000073195.1.96918 WP_000073195.1.96922 WP_000073195.1.96928 WP_000073195.1.9695 WP_000073195.1.96965 WP_000073195.1.96969 WP_000073195.1.96970 WP_000073195.1.96976 WP_000073195.1.96985 WP_000073195.1.96997 WP_000073195.1.97000 WP_000073195.1.97001 WP_000073195.1.97004 WP_000073195.1.97007 WP_000073195.1.97014 WP_000073195.1.97017 WP_000073195.1.97019 WP_000073195.1.97029 WP_000073195.1.97034 WP_000073195.1.97072 WP_000073195.1.97077 WP_000073195.1.97117 WP_000073195.1.97138 WP_000073195.1.97139 WP_000073195.1.97141 WP_000073195.1.97151 WP_000073195.1.97161 WP_000073195.1.97164 WP_000073195.1.97191 WP_000073195.1.97205 WP_000073195.1.97206 WP_000073195.1.97228 WP_000073195.1.97230 WP_000073195.1.97234 WP_000073195.1.97241 WP_000073195.1.97256 WP_000073195.1.97267 WP_000073195.1.97276 WP_000073195.1.97293 WP_000073195.1.97295 WP_000073195.1.97311 WP_000073195.1.97312 WP_000073195.1.97336 WP_000073195.1.97348 WP_000073195.1.97352 WP_000073195.1.97355 WP_000073195.1.97367 WP_000073195.1.9737 WP_000073195.1.97392 WP_000073195.1.97399 WP_000073195.1.97411 WP_000073195.1.97427 WP_000073195.1.9743 WP_000073195.1.97444 WP_000073195.1.97450 WP_000073195.1.97456 WP_000073195.1.97466 WP_000073195.1.97468 WP_000073195.1.97484 WP_000073195.1.97494 WP_000073195.1.97530 WP_000073195.1.97531 WP_000073195.1.97536 WP_000073195.1.97537 WP_000073195.1.97574 WP_000073195.1.97576 WP_000073195.1.97585 WP_000073195.1.97590 WP_000073195.1.97627 WP_000073195.1.97664 WP_000073195.1.97687 WP_000073195.1.97688 WP_000073195.1.97696 WP_000073195.1.97699 WP_000073195.1.97717 WP_000073195.1.97720 WP_000073195.1.97729 WP_000073195.1.97731 WP_000073195.1.97739 WP_000073195.1.97744 WP_000073195.1.97746 WP_000073195.1.97758 WP_000073195.1.97762 WP_000073195.1.97763 WP_000073195.1.97776 WP_000073195.1.97786 WP_000073195.1.97827 WP_000073195.1.97835 WP_000073195.1.9788 WP_000073195.1.9789 WP_000073195.1.97898 WP_000073195.1.97899 WP_000073195.1.97928 WP_000073195.1.97935 WP_000073195.1.97955 WP_000073195.1.97967 WP_000073195.1.97974 WP_000073195.1.97997 WP_000073195.1.97999 WP_000073195.1.98008 WP_000073195.1.98011 WP_000073195.1.98033 WP_000073195.1.98051 WP_000073195.1.98054 WP_000073195.1.98058 WP_000073195.1.98073 WP_000073195.1.98077 WP_000073195.1.98131 WP_000073195.1.98161 WP_000073195.1.98174 WP_000073195.1.98179 WP_000073195.1.98191 WP_000073195.1.98195 WP_000073195.1.98233 WP_000073195.1.98242 WP_000073195.1.98248 WP_000073195.1.98249 WP_000073195.1.98281 WP_000073195.1.98295 WP_000073195.1.98322 WP_000073195.1.98328 WP_000073195.1.98352 WP_000073195.1.98353 WP_000073195.1.98359 WP_000073195.1.98360 WP_000073195.1.98361 WP_000073195.1.98366 WP_000073195.1.98372 WP_000073195.1.98379 WP_000073195.1.98387 WP_000073195.1.98394 WP_000073195.1.98409 WP_000073195.1.98411 WP_000073195.1.98415 WP_000073195.1.98419 WP_000073195.1.98425 WP_000073195.1.98456 WP_000073195.1.98497 WP_000073195.1.98501 WP_000073195.1.98506 WP_000073195.1.98510 WP_000073195.1.98512 WP_000073195.1.98533 WP_000073195.1.98552 WP_000073195.1.98585 WP_000073195.1.98586 WP_000073195.1.986 WP_000073195.1.98609 WP_000073195.1.98655 WP_000073195.1.98659 WP_000073195.1.98667 WP_000073195.1.98703 WP_000073195.1.98706 WP_000073195.1.9872 WP_000073195.1.98723 WP_000073195.1.98730 WP_000073195.1.98734 WP_000073195.1.98741 WP_000073195.1.98750 WP_000073195.1.98767 WP_000073195.1.98786 WP_000073195.1.98797 WP_000073195.1.98821 WP_000073195.1.98825 WP_000073195.1.98837 WP_000073195.1.98842 WP_000073195.1.98858 WP_000073195.1.98865 WP_000073195.1.98874 WP_000073195.1.98880 WP_000073195.1.98883 WP_000073195.1.98894 WP_000073195.1.98924 WP_000073195.1.98967 WP_000073195.1.98978 WP_000073195.1.98985 WP_000073195.1.99009 WP_000073195.1.99025 WP_000073195.1.9903 WP_000073195.1.99090 WP_000073195.1.9910 WP_000073195.1.9912 WP_000073195.1.99136 WP_000073195.1.99155 WP_000073195.1.99171 WP_000073195.1.99183 WP_000073195.1.99195 WP_000073195.1.99207 WP_000073195.1.99217 WP_000073195.1.99237 WP_000073195.1.99249 WP_000073195.1.99262 WP_000073195.1.99280 WP_000073195.1.99283 WP_000073195.1.99308 WP_000073195.1.99311 WP_000073195.1.99359 WP_000073195.1.9936 WP_000073195.1.99394 WP_000073195.1.99405 WP_000073195.1.99414 WP_000073195.1.99418 WP_000073195.1.99430 WP_000073195.1.99459 WP_000073195.1.99492 WP_000073195.1.99494 WP_000073195.1.99509 WP_000073195.1.99519 WP_000073195.1.99523 WP_000073195.1.99524 WP_000073195.1.99525 WP_000073195.1.99536 WP_000073195.1.99538 WP_000073195.1.99564 WP_000073195.1.99569 WP_000073195.1.9960 WP_000073195.1.99631 WP_000073195.1.99638 WP_000073195.1.9965 WP_000073195.1.99683 WP_000073195.1.99686 WP_000073195.1.99688 WP_000073195.1.99700 WP_000073195.1.99714 WP_000073195.1.99759 WP_000073195.1.99768 WP_000073195.1.99777 WP_000073195.1.99802 WP_000073195.1.99849 WP_000073195.1.9985 WP_000073195.1.99850 WP_000073195.1.99859 WP_000073195.1.99860 WP_000073195.1.99862 WP_000073195.1.9987 WP_000073195.1.99884 WP_000073195.1.99888 WP_000073195.1.99901 WP_000073195.1.99926 WP_000073195.1.99934 WP_000073195.1.99950 WP_000073195.1.99954 WP_000073195.1.99955 WP_000073195.1.99956 WP_000073195.1.99963 WP_000073195.1.99979 WP_000073195.1.99984 WP_000073195.1.99985 WP_000073195.1.99999 YP_501051.1.76163 gi|57650857|ref|YP_187115.1| gi|470219584|ref|YP_007619978.1| gi|545635669|ref|YP_008586239.1| gi|82751908|ref|YP_417649.1| gi|554645209|ref|YP_008717000.1| gi|148268752|ref|YP_001247695.1| gi|379021977|ref|YP_005298639.1| gi|15927895|ref|NP_375428.1| gi|88196232|ref|YP_501051.1| gi|470225373|ref|YP_007623952.1| gi|15925305|ref|NP_372839.1| gi|151222429|ref|YP_001333251.1| gi|470191952|ref|YP_007578262.1| gi|49487098|ref|YP_044319.1| gi|545638527|ref|YP_008588703.1| gi|537443524|ref|YP_008486101.1| gi|387151439|ref|YP_005743003.1| gi|386831886|ref|YP_006238540.1| gi|387781275|ref|YP_005756073.1| gi|387144017|ref|YP_005732411.1| gi|385782547|ref|YP_005758718.1| gi|384548525|ref|YP_005737778.1| gi|49484531|ref|YP_041755.1| gi|384870866|ref|YP_005753580.1| gi|379015438|ref|YP_005291674.1| gi|470195883|ref|YP_007582235.1| APC85810 gi|21283965|ref|NP_647053.1| gi|470199817|ref|YP_007586217.1| gi|150394819|ref|YP_001317494.1| gi|479330314|ref|YP_007869373.1| gi|514067270|ref|YP_008129190.1| gi|470197848|ref|YP_007584249.1| gi|470223406|ref|YP_007621963.1| gi|384551098|ref|YP_005740350.1| gi|384866766|ref|YP_005746962.1| gi|384865494|ref|YP_005750853.1| 158878.SAV2315 158879.SA2108 196620.MW2236 273036.SAB2192 282458.SAR2399 282459.SAS2208 359786.SaurJH9_2339 359787.SaurJH1_2382 418127.SAHV_2299 426430.NWMN_2217 451516.USA300HOU_2298 681288.SAAV_2377 93061.SAOUHSC_02589 93062.SACOL2308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]