SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470191958|ref|YP_007578268.1| from Staphylococcus aureus ST228/10388

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470191958|ref|YP_007578268.1|
Domain Number 1 Region: 83-243
Classification Level Classification E-value
Superfamily SIS domain 2.91e-23
Family mono-SIS domain 0.051
Further Details:      
 
Domain Number 2 Region: 3-74
Classification Level Classification E-value
Superfamily Homeodomain-like 5.02e-19
Family RpiR-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470191958|ref|YP_007578268.1|
Sequence length 254
Comment Transcriptional regulator [Staphylococcus aureus subsp. aureus ST228]
Sequence
MFLDEHINRNFDKLNDNDLHIAHFINTHIDECKNMKIQDLAQFTHASNATIHRFTRKLGF
DGYSDFKSYLKFESNKTHQLPSNSIDSFKQEIDSTFSYLERVDYQLLTEKMHTASTIYLY
GTGRAQLNVASEAQRILLTLHNHVIVLHDEHELKMILNKSEPNDLFFIISLSGETHELLE
VTNLLQLRQKYFISVTTMKDNTLAQKANYNVYVSSNTFYLTDGTDYSSFISYHIFFETLV
RKYNEYLLHNDISN
Download sequence
Identical sequences A0A0D1GF60 A0A0E1VXV4 A0A0H3JRG0 A0A0H3JSX8 A0A0H3JY08 A0A168L094 A0A2H5AR39
gi|384548533|ref|YP_005737786.1| APC85816 gi|15927904|ref|NP_375437.1| gi|470223412|ref|YP_007621969.1| gi|148268762|ref|YP_001247705.1| gi|387781284|ref|YP_005756082.1| jgi|Aspzo1|146829|fgenesh1_pg.24_#_72 gi|470191958|ref|YP_007578268.1| gi|156980639|ref|YP_001442898.1| gi|470219590|ref|YP_007619984.1| gi|21283974|ref|NP_647062.1| gi|470225379|ref|YP_007623958.1| gi|470199823|ref|YP_007586223.1| gi|150394829|ref|YP_001317504.1| WP_000477989.1.10006 WP_000477989.1.100075 WP_000477989.1.100084 WP_000477989.1.100096 WP_000477989.1.100122 WP_000477989.1.10014 WP_000477989.1.100171 WP_000477989.1.100184 WP_000477989.1.100235 WP_000477989.1.100310 WP_000477989.1.10032 WP_000477989.1.100335 WP_000477989.1.100366 WP_000477989.1.100399 WP_000477989.1.10046 WP_000477989.1.100464 WP_000477989.1.10050 WP_000477989.1.100507 WP_000477989.1.100527 WP_000477989.1.100535 WP_000477989.1.100560 WP_000477989.1.100582 WP_000477989.1.100596 WP_000477989.1.100604 WP_000477989.1.100613 WP_000477989.1.100693 WP_000477989.1.100699 WP_000477989.1.100704 WP_000477989.1.100719 WP_000477989.1.100785 WP_000477989.1.100823 WP_000477989.1.100832 WP_000477989.1.10085 WP_000477989.1.100860 WP_000477989.1.100888 WP_000477989.1.1009 WP_000477989.1.100922 WP_000477989.1.100934 WP_000477989.1.100956 WP_000477989.1.10097 WP_000477989.1.100986 WP_000477989.1.101002 WP_000477989.1.101019 WP_000477989.1.101023 WP_000477989.1.101027 WP_000477989.1.101058 WP_000477989.1.101068 WP_000477989.1.101071 WP_000477989.1.101072 WP_000477989.1.101103 WP_000477989.1.10111 WP_000477989.1.101160 WP_000477989.1.101192 WP_000477989.1.101262 WP_000477989.1.101298 WP_000477989.1.101329 WP_000477989.1.101330 WP_000477989.1.101355 WP_000477989.1.101379 WP_000477989.1.101402 WP_000477989.1.101406 WP_000477989.1.101414 WP_000477989.1.101440 WP_000477989.1.101441 WP_000477989.1.10148 WP_000477989.1.1015 WP_000477989.1.101511 WP_000477989.1.101567 WP_000477989.1.101598 WP_000477989.1.101617 WP_000477989.1.101619 WP_000477989.1.101627 WP_000477989.1.101645 WP_000477989.1.10165 WP_000477989.1.101657 WP_000477989.1.101661 WP_000477989.1.101691 WP_000477989.1.101704 WP_000477989.1.101716 WP_000477989.1.101728 WP_000477989.1.101731 WP_000477989.1.101745 WP_000477989.1.101778 WP_000477989.1.101779 WP_000477989.1.101813 WP_000477989.1.101820 WP_000477989.1.101824 WP_000477989.1.101825 WP_000477989.1.101831 WP_000477989.1.101852 WP_000477989.1.101902 WP_000477989.1.101906 WP_000477989.1.101921 WP_000477989.1.101922 WP_000477989.1.101943 WP_000477989.1.102064 WP_000477989.1.102065 WP_000477989.1.102066 WP_000477989.1.102070 WP_000477989.1.102096 WP_000477989.1.102123 WP_000477989.1.102130 WP_000477989.1.10214 WP_000477989.1.10238 WP_000477989.1.10240 WP_000477989.1.10244 WP_000477989.1.10249 WP_000477989.1.1025 WP_000477989.1.10274 WP_000477989.1.10292 WP_000477989.1.10294 WP_000477989.1.10301 WP_000477989.1.1031 WP_000477989.1.1032 WP_000477989.1.10321 WP_000477989.1.10343 WP_000477989.1.1043 WP_000477989.1.10436 WP_000477989.1.10450 WP_000477989.1.10481 WP_000477989.1.1052 WP_000477989.1.10526 WP_000477989.1.10624 WP_000477989.1.10644 WP_000477989.1.10664 WP_000477989.1.10749 WP_000477989.1.10751 WP_000477989.1.1077 WP_000477989.1.10823 WP_000477989.1.10841 WP_000477989.1.10858 WP_000477989.1.1087 WP_000477989.1.10917 WP_000477989.1.10919 WP_000477989.1.10928 WP_000477989.1.10942 WP_000477989.1.10965 WP_000477989.1.1097 WP_000477989.1.10976 WP_000477989.1.10979 WP_000477989.1.10985 WP_000477989.1.10986 WP_000477989.1.11001 WP_000477989.1.11067 WP_000477989.1.11069 WP_000477989.1.11073 WP_000477989.1.11074 WP_000477989.1.11083 WP_000477989.1.11084 WP_000477989.1.1115 WP_000477989.1.11162 WP_000477989.1.11184 WP_000477989.1.11202 WP_000477989.1.11220 WP_000477989.1.11228 WP_000477989.1.11261 WP_000477989.1.11282 WP_000477989.1.11286 WP_000477989.1.11312 WP_000477989.1.11333 WP_000477989.1.11365 WP_000477989.1.11378 WP_000477989.1.11391 WP_000477989.1.11403 WP_000477989.1.11434 WP_000477989.1.11447 WP_000477989.1.11451 WP_000477989.1.1147 WP_000477989.1.11504 WP_000477989.1.1151 WP_000477989.1.11513 WP_000477989.1.1152 WP_000477989.1.11540 WP_000477989.1.11571 WP_000477989.1.11580 WP_000477989.1.11611 WP_000477989.1.11625 WP_000477989.1.11640 WP_000477989.1.11646 WP_000477989.1.11655 WP_000477989.1.11663 WP_000477989.1.1171 WP_000477989.1.11723 WP_000477989.1.11730 WP_000477989.1.11736 WP_000477989.1.11768 WP_000477989.1.11794 WP_000477989.1.11828 WP_000477989.1.11837 WP_000477989.1.11884 WP_000477989.1.11903 WP_000477989.1.11904 WP_000477989.1.11969 WP_000477989.1.12019 WP_000477989.1.12026 WP_000477989.1.12029 WP_000477989.1.12042 WP_000477989.1.1210 WP_000477989.1.1213 WP_000477989.1.12149 WP_000477989.1.12152 WP_000477989.1.12170 WP_000477989.1.12175 WP_000477989.1.12194 WP_000477989.1.12201 WP_000477989.1.12234 WP_000477989.1.12256 WP_000477989.1.12330 WP_000477989.1.12361 WP_000477989.1.12366 WP_000477989.1.12391 WP_000477989.1.12436 WP_000477989.1.12437 WP_000477989.1.12508 WP_000477989.1.12516 WP_000477989.1.1252 WP_000477989.1.12598 WP_000477989.1.12608 WP_000477989.1.12618 WP_000477989.1.12668 WP_000477989.1.12685 WP_000477989.1.12711 WP_000477989.1.12733 WP_000477989.1.12737 WP_000477989.1.1276 WP_000477989.1.12770 WP_000477989.1.12772 WP_000477989.1.12780 WP_000477989.1.12788 WP_000477989.1.12829 WP_000477989.1.12858 WP_000477989.1.12884 WP_000477989.1.12886 WP_000477989.1.12904 WP_000477989.1.12918 WP_000477989.1.12920 WP_000477989.1.12977 WP_000477989.1.13013 WP_000477989.1.13062 WP_000477989.1.13154 WP_000477989.1.13164 WP_000477989.1.13169 WP_000477989.1.13189 WP_000477989.1.13228 WP_000477989.1.13243 WP_000477989.1.13250 WP_000477989.1.13303 WP_000477989.1.13317 WP_000477989.1.13326 WP_000477989.1.13379 WP_000477989.1.13381 WP_000477989.1.13405 WP_000477989.1.13448 WP_000477989.1.13501 WP_000477989.1.13514 WP_000477989.1.13532 WP_000477989.1.13554 WP_000477989.1.13557 WP_000477989.1.13598 WP_000477989.1.13612 WP_000477989.1.13650 WP_000477989.1.13665 WP_000477989.1.13668 WP_000477989.1.13670 WP_000477989.1.13679 WP_000477989.1.13680 WP_000477989.1.13696 WP_000477989.1.13734 WP_000477989.1.1375 WP_000477989.1.13787 WP_000477989.1.13831 WP_000477989.1.13879 WP_000477989.1.13897 WP_000477989.1.13904 WP_000477989.1.13933 WP_000477989.1.13947 WP_000477989.1.13986 WP_000477989.1.13987 WP_000477989.1.14010 WP_000477989.1.14025 WP_000477989.1.14034 WP_000477989.1.14076 WP_000477989.1.14097 WP_000477989.1.14143 WP_000477989.1.14163 WP_000477989.1.14192 WP_000477989.1.1420 WP_000477989.1.14201 WP_000477989.1.1425 WP_000477989.1.14281 WP_000477989.1.1429 WP_000477989.1.14302 WP_000477989.1.14305 WP_000477989.1.14355 WP_000477989.1.14358 WP_000477989.1.14372 WP_000477989.1.14397 WP_000477989.1.14412 WP_000477989.1.14535 WP_000477989.1.1457 WP_000477989.1.14577 WP_000477989.1.14590 WP_000477989.1.14596 WP_000477989.1.14639 WP_000477989.1.14666 WP_000477989.1.1468 WP_000477989.1.14696 WP_000477989.1.1471 WP_000477989.1.14729 WP_000477989.1.14734 WP_000477989.1.14774 WP_000477989.1.14787 WP_000477989.1.14823 WP_000477989.1.14825 WP_000477989.1.14846 WP_000477989.1.14866 WP_000477989.1.14868 WP_000477989.1.14874 WP_000477989.1.14924 WP_000477989.1.14967 WP_000477989.1.14970 WP_000477989.1.15015 WP_000477989.1.15022 WP_000477989.1.15029 WP_000477989.1.15039 WP_000477989.1.15108 WP_000477989.1.15173 WP_000477989.1.15182 WP_000477989.1.15185 WP_000477989.1.1520 WP_000477989.1.15201 WP_000477989.1.15234 WP_000477989.1.15241 WP_000477989.1.1525 WP_000477989.1.15269 WP_000477989.1.15294 WP_000477989.1.15296 WP_000477989.1.15389 WP_000477989.1.15403 WP_000477989.1.15421 WP_000477989.1.15478 WP_000477989.1.15519 WP_000477989.1.15533 WP_000477989.1.15544 WP_000477989.1.15546 WP_000477989.1.15554 WP_000477989.1.15590 WP_000477989.1.15601 WP_000477989.1.1562 WP_000477989.1.1564 WP_000477989.1.1569 WP_000477989.1.15691 WP_000477989.1.15722 WP_000477989.1.15753 WP_000477989.1.15785 WP_000477989.1.15812 WP_000477989.1.159 WP_000477989.1.15920 WP_000477989.1.15921 WP_000477989.1.15939 WP_000477989.1.1599 WP_000477989.1.16018 WP_000477989.1.16068 WP_000477989.1.16095 WP_000477989.1.16096 WP_000477989.1.16114 WP_000477989.1.16140 WP_000477989.1.16173 WP_000477989.1.16195 WP_000477989.1.16203 WP_000477989.1.16223 WP_000477989.1.1623 WP_000477989.1.16251 WP_000477989.1.16265 WP_000477989.1.16276 WP_000477989.1.16283 WP_000477989.1.16311 WP_000477989.1.16395 WP_000477989.1.16407 WP_000477989.1.16433 WP_000477989.1.16458 WP_000477989.1.16589 WP_000477989.1.16606 WP_000477989.1.1662 WP_000477989.1.16632 WP_000477989.1.16639 WP_000477989.1.16649 WP_000477989.1.1665 WP_000477989.1.16651 WP_000477989.1.16653 WP_000477989.1.16664 WP_000477989.1.16684 WP_000477989.1.16747 WP_000477989.1.16761 WP_000477989.1.16762 WP_000477989.1.16794 WP_000477989.1.16815 WP_000477989.1.16824 WP_000477989.1.16833 WP_000477989.1.16880 WP_000477989.1.16882 WP_000477989.1.16920 WP_000477989.1.16925 WP_000477989.1.16936 WP_000477989.1.16938 WP_000477989.1.16969 WP_000477989.1.16986 WP_000477989.1.170 WP_000477989.1.17012 WP_000477989.1.17046 WP_000477989.1.17050 WP_000477989.1.17080 WP_000477989.1.17122 WP_000477989.1.17132 WP_000477989.1.17139 WP_000477989.1.17156 WP_000477989.1.17157 WP_000477989.1.17180 WP_000477989.1.17193 WP_000477989.1.17200 WP_000477989.1.17240 WP_000477989.1.17248 WP_000477989.1.1725 WP_000477989.1.1729 WP_000477989.1.17309 WP_000477989.1.17327 WP_000477989.1.1736 WP_000477989.1.1740 WP_000477989.1.1741 WP_000477989.1.17419 WP_000477989.1.17454 WP_000477989.1.17475 WP_000477989.1.17526 WP_000477989.1.17529 WP_000477989.1.17531 WP_000477989.1.1756 WP_000477989.1.17590 WP_000477989.1.17628 WP_000477989.1.17643 WP_000477989.1.1765 WP_000477989.1.17651 WP_000477989.1.17658 WP_000477989.1.17671 WP_000477989.1.1771 WP_000477989.1.17717 WP_000477989.1.17718 WP_000477989.1.17720 WP_000477989.1.17725 WP_000477989.1.17729 WP_000477989.1.17737 WP_000477989.1.17796 WP_000477989.1.17818 WP_000477989.1.17832 WP_000477989.1.17835 WP_000477989.1.17838 WP_000477989.1.17847 WP_000477989.1.17853 WP_000477989.1.1787 WP_000477989.1.17882 WP_000477989.1.17909 WP_000477989.1.17922 WP_000477989.1.17943 WP_000477989.1.17966 WP_000477989.1.17987 WP_000477989.1.18011 WP_000477989.1.18069 WP_000477989.1.18080 WP_000477989.1.18113 WP_000477989.1.18140 WP_000477989.1.18153 WP_000477989.1.18203 WP_000477989.1.18205 WP_000477989.1.18237 WP_000477989.1.18248 WP_000477989.1.18261 WP_000477989.1.18273 WP_000477989.1.18288 WP_000477989.1.1829 WP_000477989.1.18301 WP_000477989.1.18309 WP_000477989.1.18310 WP_000477989.1.18346 WP_000477989.1.18360 WP_000477989.1.18412 WP_000477989.1.18429 WP_000477989.1.18466 WP_000477989.1.1847 WP_000477989.1.18487 WP_000477989.1.18497 WP_000477989.1.185 WP_000477989.1.18504 WP_000477989.1.18506 WP_000477989.1.18507 WP_000477989.1.18527 WP_000477989.1.18539 WP_000477989.1.18545 WP_000477989.1.18560 WP_000477989.1.18566 WP_000477989.1.18570 WP_000477989.1.18590 WP_000477989.1.18591 WP_000477989.1.18632 WP_000477989.1.18679 WP_000477989.1.18741 WP_000477989.1.18763 WP_000477989.1.18774 WP_000477989.1.18777 WP_000477989.1.18779 WP_000477989.1.18792 WP_000477989.1.18818 WP_000477989.1.18819 WP_000477989.1.18834 WP_000477989.1.18882 WP_000477989.1.1892 WP_000477989.1.18965 WP_000477989.1.18974 WP_000477989.1.18996 WP_000477989.1.19022 WP_000477989.1.19082 WP_000477989.1.1911 WP_000477989.1.19259 WP_000477989.1.19301 WP_000477989.1.19322 WP_000477989.1.19365 WP_000477989.1.19386 WP_000477989.1.19399 WP_000477989.1.19430 WP_000477989.1.19450 WP_000477989.1.19455 WP_000477989.1.19497 WP_000477989.1.19515 WP_000477989.1.19537 WP_000477989.1.19555 WP_000477989.1.19575 WP_000477989.1.19577 WP_000477989.1.19611 WP_000477989.1.1964 WP_000477989.1.19643 WP_000477989.1.19653 WP_000477989.1.19701 WP_000477989.1.19717 WP_000477989.1.19732 WP_000477989.1.1974 WP_000477989.1.19748 WP_000477989.1.19792 WP_000477989.1.19801 WP_000477989.1.19816 WP_000477989.1.19891 WP_000477989.1.19905 WP_000477989.1.19912 WP_000477989.1.19921 WP_000477989.1.19968 WP_000477989.1.19977 WP_000477989.1.19980 WP_000477989.1.19981 WP_000477989.1.19982 WP_000477989.1.2 WP_000477989.1.20049 WP_000477989.1.20052 WP_000477989.1.2007 WP_000477989.1.20078 WP_000477989.1.2008 WP_000477989.1.20090 WP_000477989.1.20100 WP_000477989.1.20156 WP_000477989.1.20161 WP_000477989.1.20167 WP_000477989.1.20191 WP_000477989.1.20214 WP_000477989.1.20219 WP_000477989.1.20221 WP_000477989.1.20245 WP_000477989.1.2025 WP_000477989.1.20265 WP_000477989.1.2029 WP_000477989.1.20324 WP_000477989.1.20340 WP_000477989.1.20358 WP_000477989.1.20394 WP_000477989.1.20398 WP_000477989.1.20399 WP_000477989.1.20411 WP_000477989.1.20447 WP_000477989.1.20479 WP_000477989.1.20487 WP_000477989.1.20512 WP_000477989.1.2056 WP_000477989.1.20574 WP_000477989.1.20579 WP_000477989.1.20585 WP_000477989.1.20598 WP_000477989.1.20611 WP_000477989.1.20618 WP_000477989.1.20619 WP_000477989.1.20620 WP_000477989.1.20661 WP_000477989.1.20690 WP_000477989.1.20698 WP_000477989.1.20736 WP_000477989.1.20796 WP_000477989.1.20821 WP_000477989.1.20846 WP_000477989.1.20866 WP_000477989.1.20867 WP_000477989.1.20878 WP_000477989.1.20906 WP_000477989.1.20913 WP_000477989.1.20922 WP_000477989.1.20935 WP_000477989.1.20939 WP_000477989.1.20945 WP_000477989.1.20971 WP_000477989.1.21009 WP_000477989.1.21015 WP_000477989.1.21031 WP_000477989.1.21036 WP_000477989.1.21056 WP_000477989.1.21066 WP_000477989.1.21078 WP_000477989.1.21109 WP_000477989.1.21111 WP_000477989.1.21140 WP_000477989.1.21154 WP_000477989.1.21183 WP_000477989.1.2119 WP_000477989.1.21222 WP_000477989.1.21257 WP_000477989.1.21259 WP_000477989.1.21272 WP_000477989.1.2129 WP_000477989.1.21313 WP_000477989.1.21314 WP_000477989.1.21330 WP_000477989.1.21339 WP_000477989.1.2135 WP_000477989.1.21359 WP_000477989.1.21375 WP_000477989.1.21379 WP_000477989.1.21393 WP_000477989.1.21412 WP_000477989.1.21416 WP_000477989.1.21449 WP_000477989.1.21464 WP_000477989.1.21480 WP_000477989.1.21500 WP_000477989.1.21505 WP_000477989.1.21511 WP_000477989.1.21514 WP_000477989.1.21572 WP_000477989.1.21589 WP_000477989.1.2159 WP_000477989.1.2160 WP_000477989.1.21636 WP_000477989.1.21719 WP_000477989.1.21724 WP_000477989.1.21746 WP_000477989.1.21763 WP_000477989.1.2178 WP_000477989.1.21787 WP_000477989.1.21830 WP_000477989.1.21900 WP_000477989.1.21985 WP_000477989.1.21988 WP_000477989.1.2200 WP_000477989.1.22000 WP_000477989.1.22011 WP_000477989.1.22027 WP_000477989.1.22033 WP_000477989.1.22038 WP_000477989.1.22049 WP_000477989.1.22065 WP_000477989.1.22082 WP_000477989.1.22111 WP_000477989.1.22149 WP_000477989.1.22164 WP_000477989.1.22177 WP_000477989.1.22180 WP_000477989.1.22197 WP_000477989.1.22227 WP_000477989.1.22302 WP_000477989.1.22307 WP_000477989.1.22369 WP_000477989.1.22400 WP_000477989.1.22419 WP_000477989.1.22426 WP_000477989.1.22441 WP_000477989.1.22493 WP_000477989.1.22498 WP_000477989.1.22531 WP_000477989.1.22533 WP_000477989.1.22559 WP_000477989.1.22650 WP_000477989.1.22696 WP_000477989.1.22702 WP_000477989.1.22709 WP_000477989.1.22714 WP_000477989.1.22764 WP_000477989.1.22789 WP_000477989.1.22790 WP_000477989.1.22803 WP_000477989.1.22826 WP_000477989.1.22853 WP_000477989.1.22861 WP_000477989.1.22869 WP_000477989.1.22890 WP_000477989.1.22969 WP_000477989.1.22983 WP_000477989.1.22984 WP_000477989.1.23008 WP_000477989.1.23012 WP_000477989.1.23048 WP_000477989.1.23061 WP_000477989.1.23082 WP_000477989.1.23103 WP_000477989.1.23121 WP_000477989.1.23130 WP_000477989.1.23133 WP_000477989.1.23146 WP_000477989.1.23161 WP_000477989.1.23185 WP_000477989.1.23194 WP_000477989.1.23197 WP_000477989.1.23222 WP_000477989.1.23244 WP_000477989.1.23251 WP_000477989.1.2327 WP_000477989.1.23275 WP_000477989.1.23304 WP_000477989.1.23413 WP_000477989.1.23439 WP_000477989.1.23449 WP_000477989.1.23476 WP_000477989.1.23517 WP_000477989.1.23531 WP_000477989.1.23572 WP_000477989.1.23617 WP_000477989.1.23630 WP_000477989.1.23644 WP_000477989.1.23671 WP_000477989.1.23690 WP_000477989.1.23708 WP_000477989.1.23730 WP_000477989.1.23740 WP_000477989.1.23796 WP_000477989.1.23809 WP_000477989.1.23842 WP_000477989.1.2389 WP_000477989.1.23900 WP_000477989.1.23926 WP_000477989.1.23944 WP_000477989.1.23956 WP_000477989.1.23972 WP_000477989.1.23995 WP_000477989.1.24000 WP_000477989.1.24081 WP_000477989.1.24154 WP_000477989.1.24174 WP_000477989.1.24207 WP_000477989.1.24213 WP_000477989.1.24226 WP_000477989.1.24263 WP_000477989.1.2427 WP_000477989.1.24276 WP_000477989.1.24286 WP_000477989.1.24302 WP_000477989.1.2434 WP_000477989.1.24343 WP_000477989.1.24365 WP_000477989.1.24416 WP_000477989.1.24437 WP_000477989.1.24462 WP_000477989.1.24469 WP_000477989.1.2450 WP_000477989.1.24503 WP_000477989.1.24516 WP_000477989.1.24519 WP_000477989.1.24569 WP_000477989.1.24572 WP_000477989.1.24589 WP_000477989.1.24596 WP_000477989.1.24602 WP_000477989.1.24625 WP_000477989.1.24631 WP_000477989.1.24654 WP_000477989.1.24674 WP_000477989.1.24679 WP_000477989.1.24681 WP_000477989.1.24684 WP_000477989.1.24685 WP_000477989.1.24702 WP_000477989.1.24711 WP_000477989.1.24714 WP_000477989.1.24823 WP_000477989.1.24834 WP_000477989.1.24855 WP_000477989.1.24903 WP_000477989.1.24918 WP_000477989.1.24937 WP_000477989.1.2497 WP_000477989.1.24996 WP_000477989.1.25001 WP_000477989.1.25007 WP_000477989.1.2501 WP_000477989.1.25012 WP_000477989.1.2506 WP_000477989.1.25070 WP_000477989.1.25092 WP_000477989.1.25098 WP_000477989.1.25115 WP_000477989.1.25120 WP_000477989.1.25145 WP_000477989.1.25167 WP_000477989.1.25209 WP_000477989.1.25216 WP_000477989.1.25221 WP_000477989.1.25262 WP_000477989.1.25288 WP_000477989.1.25331 WP_000477989.1.25341 WP_000477989.1.25345 WP_000477989.1.25361 WP_000477989.1.2544 WP_000477989.1.25489 WP_000477989.1.2552 WP_000477989.1.25557 WP_000477989.1.25569 WP_000477989.1.25595 WP_000477989.1.25621 WP_000477989.1.25623 WP_000477989.1.25651 WP_000477989.1.25721 WP_000477989.1.25732 WP_000477989.1.25758 WP_000477989.1.25772 WP_000477989.1.25779 WP_000477989.1.25801 WP_000477989.1.25802 WP_000477989.1.25840 WP_000477989.1.25856 WP_000477989.1.25857 WP_000477989.1.2590 WP_000477989.1.25910 WP_000477989.1.25929 WP_000477989.1.25930 WP_000477989.1.26012 WP_000477989.1.26039 WP_000477989.1.26050 WP_000477989.1.26058 WP_000477989.1.2608 WP_000477989.1.26086 WP_000477989.1.26094 WP_000477989.1.26106 WP_000477989.1.26143 WP_000477989.1.26169 WP_000477989.1.2621 WP_000477989.1.26225 WP_000477989.1.26226 WP_000477989.1.26255 WP_000477989.1.26266 WP_000477989.1.26271 WP_000477989.1.26276 WP_000477989.1.26283 WP_000477989.1.26290 WP_000477989.1.26298 WP_000477989.1.26306 WP_000477989.1.26314 WP_000477989.1.26318 WP_000477989.1.26340 WP_000477989.1.26345 WP_000477989.1.26346 WP_000477989.1.26354 WP_000477989.1.26359 WP_000477989.1.26404 WP_000477989.1.26424 WP_000477989.1.2643 WP_000477989.1.26431 WP_000477989.1.26506 WP_000477989.1.26533 WP_000477989.1.26555 WP_000477989.1.26662 WP_000477989.1.26664 WP_000477989.1.26677 WP_000477989.1.26692 WP_000477989.1.26713 WP_000477989.1.2673 WP_000477989.1.26751 WP_000477989.1.26773 WP_000477989.1.26778 WP_000477989.1.2680 WP_000477989.1.26804 WP_000477989.1.2684 WP_000477989.1.26864 WP_000477989.1.26865 WP_000477989.1.26884 WP_000477989.1.2689 WP_000477989.1.26903 WP_000477989.1.26905 WP_000477989.1.26938 WP_000477989.1.26944 WP_000477989.1.26947 WP_000477989.1.27013 WP_000477989.1.27053 WP_000477989.1.27083 WP_000477989.1.2710 WP_000477989.1.27147 WP_000477989.1.27160 WP_000477989.1.27166 WP_000477989.1.27170 WP_000477989.1.2718 WP_000477989.1.27182 WP_000477989.1.2719 WP_000477989.1.27199 WP_000477989.1.27207 WP_000477989.1.27226 WP_000477989.1.27237 WP_000477989.1.27262 WP_000477989.1.27293 WP_000477989.1.27294 WP_000477989.1.27303 WP_000477989.1.27323 WP_000477989.1.27379 WP_000477989.1.27384 WP_000477989.1.27387 WP_000477989.1.27413 WP_000477989.1.2744 WP_000477989.1.27447 WP_000477989.1.27448 WP_000477989.1.27456 WP_000477989.1.27468 WP_000477989.1.27489 WP_000477989.1.27529 WP_000477989.1.2753 WP_000477989.1.27539 WP_000477989.1.27590 WP_000477989.1.27605 WP_000477989.1.27628 WP_000477989.1.27640 WP_000477989.1.27646 WP_000477989.1.27689 WP_000477989.1.27720 WP_000477989.1.27739 WP_000477989.1.27744 WP_000477989.1.27765 WP_000477989.1.27787 WP_000477989.1.27793 WP_000477989.1.27830 WP_000477989.1.2800 WP_000477989.1.28016 WP_000477989.1.28074 WP_000477989.1.2808 WP_000477989.1.28081 WP_000477989.1.28091 WP_000477989.1.28105 WP_000477989.1.28107 WP_000477989.1.28173 WP_000477989.1.28213 WP_000477989.1.28226 WP_000477989.1.28230 WP_000477989.1.28253 WP_000477989.1.28257 WP_000477989.1.28274 WP_000477989.1.28315 WP_000477989.1.28319 WP_000477989.1.28334 WP_000477989.1.28336 WP_000477989.1.28337 WP_000477989.1.28347 WP_000477989.1.28392 WP_000477989.1.28394 WP_000477989.1.28399 WP_000477989.1.2840 WP_000477989.1.28400 WP_000477989.1.28426 WP_000477989.1.28430 WP_000477989.1.28490 WP_000477989.1.28501 WP_000477989.1.2852 WP_000477989.1.28578 WP_000477989.1.28580 WP_000477989.1.28605 WP_000477989.1.28636 WP_000477989.1.28652 WP_000477989.1.28672 WP_000477989.1.28720 WP_000477989.1.28763 WP_000477989.1.28784 WP_000477989.1.28785 WP_000477989.1.28825 WP_000477989.1.28833 WP_000477989.1.28848 WP_000477989.1.28866 WP_000477989.1.28871 WP_000477989.1.28909 WP_000477989.1.28915 WP_000477989.1.28925 WP_000477989.1.28981 WP_000477989.1.28987 WP_000477989.1.29014 WP_000477989.1.29052 WP_000477989.1.2906 WP_000477989.1.29060 WP_000477989.1.29091 WP_000477989.1.29110 WP_000477989.1.29112 WP_000477989.1.29155 WP_000477989.1.29166 WP_000477989.1.29187 WP_000477989.1.29226 WP_000477989.1.29242 WP_000477989.1.29243 WP_000477989.1.29263 WP_000477989.1.29276 WP_000477989.1.29315 WP_000477989.1.29329 WP_000477989.1.29340 WP_000477989.1.29366 WP_000477989.1.29368 WP_000477989.1.29375 WP_000477989.1.29395 WP_000477989.1.29420 WP_000477989.1.29433 WP_000477989.1.29445 WP_000477989.1.29453 WP_000477989.1.29468 WP_000477989.1.29479 WP_000477989.1.29483 WP_000477989.1.29484 WP_000477989.1.29522 WP_000477989.1.29553 WP_000477989.1.29554 WP_000477989.1.29557 WP_000477989.1.2957 WP_000477989.1.29571 WP_000477989.1.29692 WP_000477989.1.29709 WP_000477989.1.29710 WP_000477989.1.29716 WP_000477989.1.2972 WP_000477989.1.29736 WP_000477989.1.29744 WP_000477989.1.29788 WP_000477989.1.29862 WP_000477989.1.29902 WP_000477989.1.29905 WP_000477989.1.29918 WP_000477989.1.29956 WP_000477989.1.29981 WP_000477989.1.30051 WP_000477989.1.30089 WP_000477989.1.30095 WP_000477989.1.3012 WP_000477989.1.30152 WP_000477989.1.30159 WP_000477989.1.30169 WP_000477989.1.30186 WP_000477989.1.30197 WP_000477989.1.30203 WP_000477989.1.30204 WP_000477989.1.30209 WP_000477989.1.30230 WP_000477989.1.30249 WP_000477989.1.30268 WP_000477989.1.3029 WP_000477989.1.30302 WP_000477989.1.30307 WP_000477989.1.30328 WP_000477989.1.30350 WP_000477989.1.30364 WP_000477989.1.30392 WP_000477989.1.30458 WP_000477989.1.30482 WP_000477989.1.30496 WP_000477989.1.3050 WP_000477989.1.30508 WP_000477989.1.30531 WP_000477989.1.30560 WP_000477989.1.30600 WP_000477989.1.30622 WP_000477989.1.30645 WP_000477989.1.30646 WP_000477989.1.30666 WP_000477989.1.30668 WP_000477989.1.30702 WP_000477989.1.30720 WP_000477989.1.30726 WP_000477989.1.3077 WP_000477989.1.30845 WP_000477989.1.30847 WP_000477989.1.30854 WP_000477989.1.30911 WP_000477989.1.31005 WP_000477989.1.31022 WP_000477989.1.31039 WP_000477989.1.31091 WP_000477989.1.31120 WP_000477989.1.31123 WP_000477989.1.31176 WP_000477989.1.31202 WP_000477989.1.31206 WP_000477989.1.31212 WP_000477989.1.31294 WP_000477989.1.31315 WP_000477989.1.3132 WP_000477989.1.31337 WP_000477989.1.31339 WP_000477989.1.31355 WP_000477989.1.31402 WP_000477989.1.31424 WP_000477989.1.31426 WP_000477989.1.31436 WP_000477989.1.31437 WP_000477989.1.31442 WP_000477989.1.31468 WP_000477989.1.31479 WP_000477989.1.31484 WP_000477989.1.31505 WP_000477989.1.31529 WP_000477989.1.31531 WP_000477989.1.31539 WP_000477989.1.31642 WP_000477989.1.31647 WP_000477989.1.31653 WP_000477989.1.31686 WP_000477989.1.31701 WP_000477989.1.31753 WP_000477989.1.31791 WP_000477989.1.31806 WP_000477989.1.31827 WP_000477989.1.31828 WP_000477989.1.31842 WP_000477989.1.31892 WP_000477989.1.31931 WP_000477989.1.31997 WP_000477989.1.32003 WP_000477989.1.32005 WP_000477989.1.32029 WP_000477989.1.32067 WP_000477989.1.32130 WP_000477989.1.32160 WP_000477989.1.3219 WP_000477989.1.32207 WP_000477989.1.32215 WP_000477989.1.32270 WP_000477989.1.3229 WP_000477989.1.32325 WP_000477989.1.32338 WP_000477989.1.32339 WP_000477989.1.32340 WP_000477989.1.32348 WP_000477989.1.3242 WP_000477989.1.32474 WP_000477989.1.32481 WP_000477989.1.32483 WP_000477989.1.32514 WP_000477989.1.32534 WP_000477989.1.32555 WP_000477989.1.32565 WP_000477989.1.32607 WP_000477989.1.32634 WP_000477989.1.32636 WP_000477989.1.32645 WP_000477989.1.32671 WP_000477989.1.32746 WP_000477989.1.32754 WP_000477989.1.32770 WP_000477989.1.32795 WP_000477989.1.328 WP_000477989.1.32800 WP_000477989.1.32925 WP_000477989.1.32928 WP_000477989.1.3293 WP_000477989.1.32939 WP_000477989.1.32954 WP_000477989.1.32965 WP_000477989.1.32980 WP_000477989.1.3301 WP_000477989.1.33038 WP_000477989.1.33048 WP_000477989.1.33067 WP_000477989.1.33110 WP_000477989.1.33123 WP_000477989.1.33138 WP_000477989.1.3316 WP_000477989.1.33161 WP_000477989.1.33199 WP_000477989.1.33212 WP_000477989.1.33250 WP_000477989.1.33266 WP_000477989.1.33292 WP_000477989.1.33296 WP_000477989.1.33335 WP_000477989.1.33357 WP_000477989.1.33368 WP_000477989.1.33416 WP_000477989.1.3342 WP_000477989.1.33432 WP_000477989.1.33468 WP_000477989.1.3347 WP_000477989.1.33507 WP_000477989.1.33516 WP_000477989.1.33518 WP_000477989.1.33540 WP_000477989.1.3357 WP_000477989.1.33610 WP_000477989.1.33626 WP_000477989.1.33627 WP_000477989.1.3363 WP_000477989.1.33640 WP_000477989.1.33654 WP_000477989.1.33692 WP_000477989.1.33695 WP_000477989.1.33718 WP_000477989.1.33720 WP_000477989.1.33735 WP_000477989.1.33743 WP_000477989.1.33765 WP_000477989.1.33769 WP_000477989.1.33792 WP_000477989.1.33804 WP_000477989.1.33813 WP_000477989.1.33816 WP_000477989.1.33855 WP_000477989.1.33915 WP_000477989.1.33940 WP_000477989.1.33963 WP_000477989.1.33968 WP_000477989.1.33983 WP_000477989.1.34026 WP_000477989.1.34030 WP_000477989.1.34051 WP_000477989.1.34062 WP_000477989.1.34079 WP_000477989.1.34089 WP_000477989.1.34100 WP_000477989.1.34128 WP_000477989.1.34132 WP_000477989.1.34168 WP_000477989.1.34182 WP_000477989.1.34209 WP_000477989.1.3422 WP_000477989.1.34223 WP_000477989.1.34231 WP_000477989.1.34244 WP_000477989.1.34249 WP_000477989.1.34250 WP_000477989.1.34251 WP_000477989.1.34285 WP_000477989.1.34334 WP_000477989.1.34371 WP_000477989.1.34381 WP_000477989.1.34403 WP_000477989.1.34410 WP_000477989.1.34436 WP_000477989.1.3448 WP_000477989.1.34482 WP_000477989.1.34492 WP_000477989.1.34502 WP_000477989.1.34510 WP_000477989.1.34526 WP_000477989.1.34531 WP_000477989.1.3461 WP_000477989.1.34626 WP_000477989.1.34666 WP_000477989.1.34737 WP_000477989.1.34767 WP_000477989.1.34818 WP_000477989.1.34890 WP_000477989.1.34918 WP_000477989.1.34970 WP_000477989.1.35059 WP_000477989.1.35062 WP_000477989.1.35089 WP_000477989.1.35097 WP_000477989.1.35106 WP_000477989.1.35108 WP_000477989.1.35110 WP_000477989.1.35121 WP_000477989.1.35177 WP_000477989.1.35189 WP_000477989.1.35222 WP_000477989.1.35233 WP_000477989.1.35257 WP_000477989.1.35276 WP_000477989.1.35285 WP_000477989.1.35297 WP_000477989.1.35307 WP_000477989.1.35334 WP_000477989.1.35342 WP_000477989.1.35352 WP_000477989.1.354 WP_000477989.1.35415 WP_000477989.1.3542 WP_000477989.1.3547 WP_000477989.1.35490 WP_000477989.1.35497 WP_000477989.1.35498 WP_000477989.1.3552 WP_000477989.1.35525 WP_000477989.1.35580 WP_000477989.1.35615 WP_000477989.1.35623 WP_000477989.1.35659 WP_000477989.1.35673 WP_000477989.1.3569 WP_000477989.1.35746 WP_000477989.1.35774 WP_000477989.1.35794 WP_000477989.1.35799 WP_000477989.1.35801 WP_000477989.1.35826 WP_000477989.1.35888 WP_000477989.1.35900 WP_000477989.1.35928 WP_000477989.1.35950 WP_000477989.1.36004 WP_000477989.1.36021 WP_000477989.1.36082 WP_000477989.1.36102 WP_000477989.1.36117 WP_000477989.1.36119 WP_000477989.1.36141 WP_000477989.1.3617 WP_000477989.1.36175 WP_000477989.1.36176 WP_000477989.1.36187 WP_000477989.1.36188 WP_000477989.1.36193 WP_000477989.1.36211 WP_000477989.1.36220 WP_000477989.1.3623 WP_000477989.1.36250 WP_000477989.1.36264 WP_000477989.1.36278 WP_000477989.1.36282 WP_000477989.1.36283 WP_000477989.1.36307 WP_000477989.1.36325 WP_000477989.1.36344 WP_000477989.1.36522 WP_000477989.1.36532 WP_000477989.1.36535 WP_000477989.1.3655 WP_000477989.1.36551 WP_000477989.1.36570 WP_000477989.1.36580 WP_000477989.1.36600 WP_000477989.1.36604 WP_000477989.1.36615 WP_000477989.1.36646 WP_000477989.1.3666 WP_000477989.1.36669 WP_000477989.1.36689 WP_000477989.1.36697 WP_000477989.1.36745 WP_000477989.1.3675 WP_000477989.1.36770 WP_000477989.1.36783 WP_000477989.1.36793 WP_000477989.1.36796 WP_000477989.1.36809 WP_000477989.1.36822 WP_000477989.1.36823 WP_000477989.1.3685 WP_000477989.1.36858 WP_000477989.1.3687 WP_000477989.1.36884 WP_000477989.1.36932 WP_000477989.1.36952 WP_000477989.1.36955 WP_000477989.1.36979 WP_000477989.1.36980 WP_000477989.1.36983 WP_000477989.1.36997 WP_000477989.1.37002 WP_000477989.1.37016 WP_000477989.1.3703 WP_000477989.1.37044 WP_000477989.1.37053 WP_000477989.1.37055 WP_000477989.1.37080 WP_000477989.1.37121 WP_000477989.1.37132 WP_000477989.1.37134 WP_000477989.1.37135 WP_000477989.1.37220 WP_000477989.1.37304 WP_000477989.1.37341 WP_000477989.1.37354 WP_000477989.1.37398 WP_000477989.1.37424 WP_000477989.1.37503 WP_000477989.1.37536 WP_000477989.1.37563 WP_000477989.1.37583 WP_000477989.1.37602 WP_000477989.1.37605 WP_000477989.1.37606 WP_000477989.1.37621 WP_000477989.1.37624 WP_000477989.1.37636 WP_000477989.1.37652 WP_000477989.1.3776 WP_000477989.1.37781 WP_000477989.1.37795 WP_000477989.1.37815 WP_000477989.1.37828 WP_000477989.1.3784 WP_000477989.1.37987 WP_000477989.1.38007 WP_000477989.1.38038 WP_000477989.1.38057 WP_000477989.1.38070 WP_000477989.1.38082 WP_000477989.1.3809 WP_000477989.1.38160 WP_000477989.1.38177 WP_000477989.1.3820 WP_000477989.1.38230 WP_000477989.1.38232 WP_000477989.1.3827 WP_000477989.1.38276 WP_000477989.1.38282 WP_000477989.1.38309 WP_000477989.1.38311 WP_000477989.1.38316 WP_000477989.1.38330 WP_000477989.1.38336 WP_000477989.1.38339 WP_000477989.1.38346 WP_000477989.1.38383 WP_000477989.1.38390 WP_000477989.1.3842 WP_000477989.1.38435 WP_000477989.1.38437 WP_000477989.1.38453 WP_000477989.1.38489 WP_000477989.1.38493 WP_000477989.1.3850 WP_000477989.1.38522 WP_000477989.1.38546 WP_000477989.1.38551 WP_000477989.1.38600 WP_000477989.1.38607 WP_000477989.1.38612 WP_000477989.1.38637 WP_000477989.1.3867 WP_000477989.1.38674 WP_000477989.1.38721 WP_000477989.1.38760 WP_000477989.1.38823 WP_000477989.1.38841 WP_000477989.1.38858 WP_000477989.1.38862 WP_000477989.1.38926 WP_000477989.1.38931 WP_000477989.1.3894 WP_000477989.1.38940 WP_000477989.1.38941 WP_000477989.1.38960 WP_000477989.1.38972 WP_000477989.1.38989 WP_000477989.1.390 WP_000477989.1.39012 WP_000477989.1.39014 WP_000477989.1.39020 WP_000477989.1.39043 WP_000477989.1.39053 WP_000477989.1.3906 WP_000477989.1.391 WP_000477989.1.39108 WP_000477989.1.39117 WP_000477989.1.39173 WP_000477989.1.39203 WP_000477989.1.39206 WP_000477989.1.39217 WP_000477989.1.3926 WP_000477989.1.39272 WP_000477989.1.39281 WP_000477989.1.39290 WP_000477989.1.39332 WP_000477989.1.39333 WP_000477989.1.39368 WP_000477989.1.39397 WP_000477989.1.39406 WP_000477989.1.39451 WP_000477989.1.39486 WP_000477989.1.39506 WP_000477989.1.39527 WP_000477989.1.39550 WP_000477989.1.39625 WP_000477989.1.39645 WP_000477989.1.39662 WP_000477989.1.39687 WP_000477989.1.39689 WP_000477989.1.39697 WP_000477989.1.39711 WP_000477989.1.39738 WP_000477989.1.39767 WP_000477989.1.39773 WP_000477989.1.39789 WP_000477989.1.39812 WP_000477989.1.39832 WP_000477989.1.39834 WP_000477989.1.39838 WP_000477989.1.39839 WP_000477989.1.39856 WP_000477989.1.39869 WP_000477989.1.39875 WP_000477989.1.39880 WP_000477989.1.39918 WP_000477989.1.40014 WP_000477989.1.40043 WP_000477989.1.40053 WP_000477989.1.4006 WP_000477989.1.40085 WP_000477989.1.40099 WP_000477989.1.4012 WP_000477989.1.40120 WP_000477989.1.40130 WP_000477989.1.40137 WP_000477989.1.4015 WP_000477989.1.40164 WP_000477989.1.40173 WP_000477989.1.4019 WP_000477989.1.40220 WP_000477989.1.4025 WP_000477989.1.40299 WP_000477989.1.40316 WP_000477989.1.40318 WP_000477989.1.40320 WP_000477989.1.40322 WP_000477989.1.40330 WP_000477989.1.40340 WP_000477989.1.40342 WP_000477989.1.40368 WP_000477989.1.40406 WP_000477989.1.40409 WP_000477989.1.40435 WP_000477989.1.4045 WP_000477989.1.40472 WP_000477989.1.40474 WP_000477989.1.40481 WP_000477989.1.40505 WP_000477989.1.40531 WP_000477989.1.40532 WP_000477989.1.4056 WP_000477989.1.40579 WP_000477989.1.40588 WP_000477989.1.40620 WP_000477989.1.40644 WP_000477989.1.40655 WP_000477989.1.40658 WP_000477989.1.40659 WP_000477989.1.4078 WP_000477989.1.40794 WP_000477989.1.40797 WP_000477989.1.40816 WP_000477989.1.40954 WP_000477989.1.41064 WP_000477989.1.41066 WP_000477989.1.41084 WP_000477989.1.41094 WP_000477989.1.41098 WP_000477989.1.41109 WP_000477989.1.41119 WP_000477989.1.41129 WP_000477989.1.4115 WP_000477989.1.41178 WP_000477989.1.412 WP_000477989.1.41208 WP_000477989.1.41238 WP_000477989.1.41241 WP_000477989.1.41245 WP_000477989.1.41255 WP_000477989.1.41288 WP_000477989.1.41289 WP_000477989.1.4129 WP_000477989.1.41314 WP_000477989.1.4138 WP_000477989.1.41411 WP_000477989.1.41426 WP_000477989.1.41432 WP_000477989.1.41433 WP_000477989.1.41444 WP_000477989.1.41448 WP_000477989.1.41461 WP_000477989.1.41499 WP_000477989.1.41511 WP_000477989.1.41558 WP_000477989.1.41567 WP_000477989.1.41582 WP_000477989.1.41599 WP_000477989.1.4160 WP_000477989.1.4162 WP_000477989.1.41623 WP_000477989.1.41647 WP_000477989.1.41674 WP_000477989.1.41726 WP_000477989.1.41770 WP_000477989.1.41839 WP_000477989.1.4188 WP_000477989.1.41898 WP_000477989.1.41906 WP_000477989.1.41935 WP_000477989.1.41943 WP_000477989.1.41989 WP_000477989.1.420 WP_000477989.1.42005 WP_000477989.1.42015 WP_000477989.1.42017 WP_000477989.1.42028 WP_000477989.1.42064 WP_000477989.1.42087 WP_000477989.1.42125 WP_000477989.1.42137 WP_000477989.1.42177 WP_000477989.1.42198 WP_000477989.1.42269 WP_000477989.1.42286 WP_000477989.1.42305 WP_000477989.1.4231 WP_000477989.1.42336 WP_000477989.1.42403 WP_000477989.1.42436 WP_000477989.1.42438 WP_000477989.1.42455 WP_000477989.1.42459 WP_000477989.1.42481 WP_000477989.1.42503 WP_000477989.1.42510 WP_000477989.1.42517 WP_000477989.1.42575 WP_000477989.1.42593 WP_000477989.1.42598 WP_000477989.1.426 WP_000477989.1.4260 WP_000477989.1.42640 WP_000477989.1.42652 WP_000477989.1.42667 WP_000477989.1.42668 WP_000477989.1.42674 WP_000477989.1.42679 WP_000477989.1.42706 WP_000477989.1.42737 WP_000477989.1.42759 WP_000477989.1.42786 WP_000477989.1.42802 WP_000477989.1.42837 WP_000477989.1.42893 WP_000477989.1.42897 WP_000477989.1.4293 WP_000477989.1.42982 WP_000477989.1.42985 WP_000477989.1.4299 WP_000477989.1.43014 WP_000477989.1.43033 WP_000477989.1.43047 WP_000477989.1.43072 WP_000477989.1.43122 WP_000477989.1.43131 WP_000477989.1.43134 WP_000477989.1.43143 WP_000477989.1.43147 WP_000477989.1.43165 WP_000477989.1.43202 WP_000477989.1.43225 WP_000477989.1.43248 WP_000477989.1.4325 WP_000477989.1.43263 WP_000477989.1.4327 WP_000477989.1.43274 WP_000477989.1.43323 WP_000477989.1.43325 WP_000477989.1.43328 WP_000477989.1.43331 WP_000477989.1.43341 WP_000477989.1.43349 WP_000477989.1.43366 WP_000477989.1.43369 WP_000477989.1.4337 WP_000477989.1.43406 WP_000477989.1.4341 WP_000477989.1.43410 WP_000477989.1.43414 WP_000477989.1.4347 WP_000477989.1.43530 WP_000477989.1.43550 WP_000477989.1.43560 WP_000477989.1.43573 WP_000477989.1.43600 WP_000477989.1.43617 WP_000477989.1.43618 WP_000477989.1.43627 WP_000477989.1.43659 WP_000477989.1.43670 WP_000477989.1.43683 WP_000477989.1.43693 WP_000477989.1.4370 WP_000477989.1.43702 WP_000477989.1.43703 WP_000477989.1.4372 WP_000477989.1.4374 WP_000477989.1.43752 WP_000477989.1.43788 WP_000477989.1.4380 WP_000477989.1.43800 WP_000477989.1.43819 WP_000477989.1.43822 WP_000477989.1.43827 WP_000477989.1.4385 WP_000477989.1.43851 WP_000477989.1.43904 WP_000477989.1.43915 WP_000477989.1.43924 WP_000477989.1.43984 WP_000477989.1.44072 WP_000477989.1.44119 WP_000477989.1.44153 WP_000477989.1.44181 WP_000477989.1.44195 WP_000477989.1.44265 WP_000477989.1.44302 WP_000477989.1.44312 WP_000477989.1.44388 WP_000477989.1.44396 WP_000477989.1.44405 WP_000477989.1.44420 WP_000477989.1.44455 WP_000477989.1.44493 WP_000477989.1.44517 WP_000477989.1.44544 WP_000477989.1.44579 WP_000477989.1.44588 WP_000477989.1.44605 WP_000477989.1.44631 WP_000477989.1.44672 WP_000477989.1.44674 WP_000477989.1.44732 WP_000477989.1.44755 WP_000477989.1.44768 WP_000477989.1.44780 WP_000477989.1.44785 WP_000477989.1.44788 WP_000477989.1.44796 WP_000477989.1.44802 WP_000477989.1.44853 WP_000477989.1.44881 WP_000477989.1.44882 WP_000477989.1.44891 WP_000477989.1.44899 WP_000477989.1.44903 WP_000477989.1.44914 WP_000477989.1.44932 WP_000477989.1.44955 WP_000477989.1.44969 WP_000477989.1.45015 WP_000477989.1.45033 WP_000477989.1.45035 WP_000477989.1.45050 WP_000477989.1.45099 WP_000477989.1.45111 WP_000477989.1.4513 WP_000477989.1.45131 WP_000477989.1.45132 WP_000477989.1.45133 WP_000477989.1.45164 WP_000477989.1.45170 WP_000477989.1.45188 WP_000477989.1.45189 WP_000477989.1.452 WP_000477989.1.45218 WP_000477989.1.45272 WP_000477989.1.45290 WP_000477989.1.45297 WP_000477989.1.453 WP_000477989.1.45321 WP_000477989.1.45332 WP_000477989.1.45364 WP_000477989.1.45419 WP_000477989.1.45431 WP_000477989.1.45439 WP_000477989.1.45472 WP_000477989.1.45492 WP_000477989.1.4550 WP_000477989.1.45507 WP_000477989.1.45560 WP_000477989.1.45577 WP_000477989.1.45586 WP_000477989.1.45620 WP_000477989.1.45640 WP_000477989.1.45654 WP_000477989.1.45670 WP_000477989.1.45698 WP_000477989.1.45713 WP_000477989.1.45730 WP_000477989.1.45734 WP_000477989.1.45747 WP_000477989.1.45768 WP_000477989.1.45771 WP_000477989.1.45780 WP_000477989.1.4580 WP_000477989.1.4584 WP_000477989.1.45852 WP_000477989.1.45870 WP_000477989.1.45875 WP_000477989.1.45881 WP_000477989.1.45888 WP_000477989.1.45897 WP_000477989.1.459 WP_000477989.1.45954 WP_000477989.1.4598 WP_000477989.1.46003 WP_000477989.1.46005 WP_000477989.1.46055 WP_000477989.1.46071 WP_000477989.1.46087 WP_000477989.1.46106 WP_000477989.1.46136 WP_000477989.1.46168 WP_000477989.1.46195 WP_000477989.1.46208 WP_000477989.1.46212 WP_000477989.1.46222 WP_000477989.1.46228 WP_000477989.1.46276 WP_000477989.1.46320 WP_000477989.1.46330 WP_000477989.1.46334 WP_000477989.1.46362 WP_000477989.1.46368 WP_000477989.1.46380 WP_000477989.1.46389 WP_000477989.1.46401 WP_000477989.1.46422 WP_000477989.1.46457 WP_000477989.1.46465 WP_000477989.1.46514 WP_000477989.1.46528 WP_000477989.1.46534 WP_000477989.1.46543 WP_000477989.1.46608 WP_000477989.1.4662 WP_000477989.1.46664 WP_000477989.1.46670 WP_000477989.1.46676 WP_000477989.1.46688 WP_000477989.1.46692 WP_000477989.1.46703 WP_000477989.1.46752 WP_000477989.1.46765 WP_000477989.1.46767 WP_000477989.1.46772 WP_000477989.1.46815 WP_000477989.1.46823 WP_000477989.1.46837 WP_000477989.1.46852 WP_000477989.1.46875 WP_000477989.1.46881 WP_000477989.1.46908 WP_000477989.1.46925 WP_000477989.1.46937 WP_000477989.1.4696 WP_000477989.1.46964 WP_000477989.1.46983 WP_000477989.1.46995 WP_000477989.1.47051 WP_000477989.1.47065 WP_000477989.1.47090 WP_000477989.1.47128 WP_000477989.1.47153 WP_000477989.1.47159 WP_000477989.1.4716 WP_000477989.1.47163 WP_000477989.1.47175 WP_000477989.1.47187 WP_000477989.1.47193 WP_000477989.1.47205 WP_000477989.1.47211 WP_000477989.1.47218 WP_000477989.1.47258 WP_000477989.1.47269 WP_000477989.1.47279 WP_000477989.1.47290 WP_000477989.1.47294 WP_000477989.1.47306 WP_000477989.1.47317 WP_000477989.1.47328 WP_000477989.1.47331 WP_000477989.1.47353 WP_000477989.1.47381 WP_000477989.1.47383 WP_000477989.1.47399 WP_000477989.1.47405 WP_000477989.1.47422 WP_000477989.1.47426 WP_000477989.1.47432 WP_000477989.1.47439 WP_000477989.1.47450 WP_000477989.1.47493 WP_000477989.1.4752 WP_000477989.1.47541 WP_000477989.1.47560 WP_000477989.1.47561 WP_000477989.1.47570 WP_000477989.1.47577 WP_000477989.1.47618 WP_000477989.1.47629 WP_000477989.1.4767 WP_000477989.1.477 WP_000477989.1.47702 WP_000477989.1.47733 WP_000477989.1.47763 WP_000477989.1.47782 WP_000477989.1.47792 WP_000477989.1.47821 WP_000477989.1.47835 WP_000477989.1.47836 WP_000477989.1.47859 WP_000477989.1.47864 WP_000477989.1.47872 WP_000477989.1.47873 WP_000477989.1.47901 WP_000477989.1.47904 WP_000477989.1.47951 WP_000477989.1.47980 WP_000477989.1.47996 WP_000477989.1.48009 WP_000477989.1.48011 WP_000477989.1.48030 WP_000477989.1.48047 WP_000477989.1.4805 WP_000477989.1.48057 WP_000477989.1.48149 WP_000477989.1.4815 WP_000477989.1.48154 WP_000477989.1.48169 WP_000477989.1.48199 WP_000477989.1.48212 WP_000477989.1.48227 WP_000477989.1.48236 WP_000477989.1.48250 WP_000477989.1.48284 WP_000477989.1.48293 WP_000477989.1.48307 WP_000477989.1.48322 WP_000477989.1.48326 WP_000477989.1.48335 WP_000477989.1.48364 WP_000477989.1.48391 WP_000477989.1.48394 WP_000477989.1.484 WP_000477989.1.48463 WP_000477989.1.48492 WP_000477989.1.48556 WP_000477989.1.48563 WP_000477989.1.48577 WP_000477989.1.48593 WP_000477989.1.48634 WP_000477989.1.48656 WP_000477989.1.4868 WP_000477989.1.48694 WP_000477989.1.48705 WP_000477989.1.48711 WP_000477989.1.48786 WP_000477989.1.48805 WP_000477989.1.48817 WP_000477989.1.48823 WP_000477989.1.48833 WP_000477989.1.48835 WP_000477989.1.4886 WP_000477989.1.48936 WP_000477989.1.48941 WP_000477989.1.48945 WP_000477989.1.48951 WP_000477989.1.48968 WP_000477989.1.48982 WP_000477989.1.48993 WP_000477989.1.4901 WP_000477989.1.49032 WP_000477989.1.4905 WP_000477989.1.49128 WP_000477989.1.49129 WP_000477989.1.49150 WP_000477989.1.49152 WP_000477989.1.4916 WP_000477989.1.4917 WP_000477989.1.4918 WP_000477989.1.49207 WP_000477989.1.4921 WP_000477989.1.49248 WP_000477989.1.49327 WP_000477989.1.49398 WP_000477989.1.49479 WP_000477989.1.49484 WP_000477989.1.4950 WP_000477989.1.49530 WP_000477989.1.49539 WP_000477989.1.49573 WP_000477989.1.49605 WP_000477989.1.4962 WP_000477989.1.49658 WP_000477989.1.49669 WP_000477989.1.49671 WP_000477989.1.49707 WP_000477989.1.49730 WP_000477989.1.49742 WP_000477989.1.49757 WP_000477989.1.4980 WP_000477989.1.49800 WP_000477989.1.4982 WP_000477989.1.49860 WP_000477989.1.49863 WP_000477989.1.4987 WP_000477989.1.4989 WP_000477989.1.49894 WP_000477989.1.49907 WP_000477989.1.49917 WP_000477989.1.49921 WP_000477989.1.49934 WP_000477989.1.4994 WP_000477989.1.49943 WP_000477989.1.49951 WP_000477989.1.49982 WP_000477989.1.50013 WP_000477989.1.50023 WP_000477989.1.50038 WP_000477989.1.50039 WP_000477989.1.50061 WP_000477989.1.50064 WP_000477989.1.50076 WP_000477989.1.5013 WP_000477989.1.50138 WP_000477989.1.50175 WP_000477989.1.50212 WP_000477989.1.50217 WP_000477989.1.50219 WP_000477989.1.50261 WP_000477989.1.50313 WP_000477989.1.50314 WP_000477989.1.5035 WP_000477989.1.50369 WP_000477989.1.50424 WP_000477989.1.50430 WP_000477989.1.50440 WP_000477989.1.50477 WP_000477989.1.50527 WP_000477989.1.50536 WP_000477989.1.50543 WP_000477989.1.50555 WP_000477989.1.50578 WP_000477989.1.50595 WP_000477989.1.50660 WP_000477989.1.50732 WP_000477989.1.50742 WP_000477989.1.50748 WP_000477989.1.50768 WP_000477989.1.50799 WP_000477989.1.5087 WP_000477989.1.50884 WP_000477989.1.50896 WP_000477989.1.50937 WP_000477989.1.50958 WP_000477989.1.50962 WP_000477989.1.5108 WP_000477989.1.5110 WP_000477989.1.5111 WP_000477989.1.51152 WP_000477989.1.5117 WP_000477989.1.51194 WP_000477989.1.51220 WP_000477989.1.51236 WP_000477989.1.51245 WP_000477989.1.51250 WP_000477989.1.51282 WP_000477989.1.51295 WP_000477989.1.51306 WP_000477989.1.51310 WP_000477989.1.51346 WP_000477989.1.51376 WP_000477989.1.51377 WP_000477989.1.51403 WP_000477989.1.51418 WP_000477989.1.5145 WP_000477989.1.51454 WP_000477989.1.51456 WP_000477989.1.51465 WP_000477989.1.51469 WP_000477989.1.51492 WP_000477989.1.515 WP_000477989.1.51527 WP_000477989.1.5155 WP_000477989.1.51559 WP_000477989.1.51571 WP_000477989.1.51575 WP_000477989.1.51590 WP_000477989.1.51619 WP_000477989.1.51623 WP_000477989.1.51657 WP_000477989.1.51665 WP_000477989.1.51672 WP_000477989.1.51702 WP_000477989.1.51713 WP_000477989.1.51716 WP_000477989.1.51744 WP_000477989.1.51748 WP_000477989.1.51751 WP_000477989.1.51797 WP_000477989.1.51836 WP_000477989.1.51842 WP_000477989.1.51844 WP_000477989.1.5186 WP_000477989.1.51866 WP_000477989.1.51871 WP_000477989.1.51883 WP_000477989.1.51912 WP_000477989.1.51924 WP_000477989.1.51936 WP_000477989.1.51952 WP_000477989.1.51971 WP_000477989.1.51995 WP_000477989.1.52078 WP_000477989.1.521 WP_000477989.1.5213 WP_000477989.1.52151 WP_000477989.1.52185 WP_000477989.1.52193 WP_000477989.1.52251 WP_000477989.1.52296 WP_000477989.1.523 WP_000477989.1.5231 WP_000477989.1.52322 WP_000477989.1.52327 WP_000477989.1.52331 WP_000477989.1.52340 WP_000477989.1.52423 WP_000477989.1.52440 WP_000477989.1.52442 WP_000477989.1.52464 WP_000477989.1.52474 WP_000477989.1.52518 WP_000477989.1.52548 WP_000477989.1.52595 WP_000477989.1.52602 WP_000477989.1.52622 WP_000477989.1.52623 WP_000477989.1.52624 WP_000477989.1.52633 WP_000477989.1.52645 WP_000477989.1.52660 WP_000477989.1.52670 WP_000477989.1.52687 WP_000477989.1.52699 WP_000477989.1.52715 WP_000477989.1.52722 WP_000477989.1.52751 WP_000477989.1.52828 WP_000477989.1.52848 WP_000477989.1.52878 WP_000477989.1.52886 WP_000477989.1.52941 WP_000477989.1.52947 WP_000477989.1.52984 WP_000477989.1.52992 WP_000477989.1.53002 WP_000477989.1.53022 WP_000477989.1.53060 WP_000477989.1.53069 WP_000477989.1.53071 WP_000477989.1.53109 WP_000477989.1.53140 WP_000477989.1.53153 WP_000477989.1.53178 WP_000477989.1.53209 WP_000477989.1.5323 WP_000477989.1.53260 WP_000477989.1.53317 WP_000477989.1.53319 WP_000477989.1.53323 WP_000477989.1.53352 WP_000477989.1.5336 WP_000477989.1.53366 WP_000477989.1.53372 WP_000477989.1.53383 WP_000477989.1.53387 WP_000477989.1.53394 WP_000477989.1.53403 WP_000477989.1.53418 WP_000477989.1.53432 WP_000477989.1.53444 WP_000477989.1.53462 WP_000477989.1.53488 WP_000477989.1.53503 WP_000477989.1.53521 WP_000477989.1.53577 WP_000477989.1.53641 WP_000477989.1.53648 WP_000477989.1.53671 WP_000477989.1.53691 WP_000477989.1.53758 WP_000477989.1.53759 WP_000477989.1.53766 WP_000477989.1.5382 WP_000477989.1.53835 WP_000477989.1.53889 WP_000477989.1.53915 WP_000477989.1.53924 WP_000477989.1.53934 WP_000477989.1.53969 WP_000477989.1.53999 WP_000477989.1.5401 WP_000477989.1.54022 WP_000477989.1.54109 WP_000477989.1.54147 WP_000477989.1.54199 WP_000477989.1.54229 WP_000477989.1.54253 WP_000477989.1.54282 WP_000477989.1.54297 WP_000477989.1.54332 WP_000477989.1.54395 WP_000477989.1.544 WP_000477989.1.54413 WP_000477989.1.54426 WP_000477989.1.54446 WP_000477989.1.54491 WP_000477989.1.54503 WP_000477989.1.54510 WP_000477989.1.54518 WP_000477989.1.54539 WP_000477989.1.54543 WP_000477989.1.54551 WP_000477989.1.54572 WP_000477989.1.54637 WP_000477989.1.54675 WP_000477989.1.5469 WP_000477989.1.54728 WP_000477989.1.54733 WP_000477989.1.54745 WP_000477989.1.54753 WP_000477989.1.54819 WP_000477989.1.54826 WP_000477989.1.54878 WP_000477989.1.54955 WP_000477989.1.54995 WP_000477989.1.55014 WP_000477989.1.55058 WP_000477989.1.5519 WP_000477989.1.55192 WP_000477989.1.55214 WP_000477989.1.55220 WP_000477989.1.55272 WP_000477989.1.55274 WP_000477989.1.55301 WP_000477989.1.55306 WP_000477989.1.55309 WP_000477989.1.55353 WP_000477989.1.5536 WP_000477989.1.55367 WP_000477989.1.55369 WP_000477989.1.55403 WP_000477989.1.55405 WP_000477989.1.55421 WP_000477989.1.55442 WP_000477989.1.55508 WP_000477989.1.55538 WP_000477989.1.5554 WP_000477989.1.55544 WP_000477989.1.55558 WP_000477989.1.5556 WP_000477989.1.55573 WP_000477989.1.55583 WP_000477989.1.5562 WP_000477989.1.55628 WP_000477989.1.55637 WP_000477989.1.55653 WP_000477989.1.55657 WP_000477989.1.557 WP_000477989.1.55717 WP_000477989.1.55728 WP_000477989.1.55746 WP_000477989.1.55784 WP_000477989.1.55786 WP_000477989.1.5580 WP_000477989.1.55818 WP_000477989.1.55831 WP_000477989.1.55835 WP_000477989.1.55854 WP_000477989.1.55867 WP_000477989.1.55886 WP_000477989.1.5589 WP_000477989.1.5590 WP_000477989.1.55904 WP_000477989.1.55916 WP_000477989.1.55933 WP_000477989.1.55949 WP_000477989.1.55953 WP_000477989.1.55960 WP_000477989.1.56000 WP_000477989.1.56025 WP_000477989.1.56039 WP_000477989.1.56048 WP_000477989.1.56078 WP_000477989.1.56098 WP_000477989.1.56153 WP_000477989.1.56214 WP_000477989.1.56225 WP_000477989.1.5623 WP_000477989.1.56281 WP_000477989.1.56332 WP_000477989.1.56333 WP_000477989.1.56343 WP_000477989.1.56377 WP_000477989.1.56400 WP_000477989.1.5644 WP_000477989.1.56453 WP_000477989.1.56496 WP_000477989.1.56530 WP_000477989.1.56558 WP_000477989.1.56570 WP_000477989.1.5658 WP_000477989.1.56584 WP_000477989.1.56598 WP_000477989.1.566 WP_000477989.1.56628 WP_000477989.1.56641 WP_000477989.1.5665 WP_000477989.1.56658 WP_000477989.1.5666 WP_000477989.1.56723 WP_000477989.1.56767 WP_000477989.1.5677 WP_000477989.1.56778 WP_000477989.1.56794 WP_000477989.1.56806 WP_000477989.1.56815 WP_000477989.1.56856 WP_000477989.1.5686 WP_000477989.1.56865 WP_000477989.1.56878 WP_000477989.1.569 WP_000477989.1.56986 WP_000477989.1.57047 WP_000477989.1.57073 WP_000477989.1.57075 WP_000477989.1.57080 WP_000477989.1.57097 WP_000477989.1.57109 WP_000477989.1.57170 WP_000477989.1.57175 WP_000477989.1.5718 WP_000477989.1.57190 WP_000477989.1.57196 WP_000477989.1.57214 WP_000477989.1.57223 WP_000477989.1.57265 WP_000477989.1.57309 WP_000477989.1.57316 WP_000477989.1.57370 WP_000477989.1.57376 WP_000477989.1.57389 WP_000477989.1.57445 WP_000477989.1.57459 WP_000477989.1.57481 WP_000477989.1.5749 WP_000477989.1.57507 WP_000477989.1.5752 WP_000477989.1.57577 WP_000477989.1.57594 WP_000477989.1.5763 WP_000477989.1.57650 WP_000477989.1.57665 WP_000477989.1.57682 WP_000477989.1.5770 WP_000477989.1.57720 WP_000477989.1.57723 WP_000477989.1.57730 WP_000477989.1.57734 WP_000477989.1.57754 WP_000477989.1.57761 WP_000477989.1.57770 WP_000477989.1.57808 WP_000477989.1.57819 WP_000477989.1.57837 WP_000477989.1.57840 WP_000477989.1.57861 WP_000477989.1.57878 WP_000477989.1.57888 WP_000477989.1.579 WP_000477989.1.5791 WP_000477989.1.57910 WP_000477989.1.57915 WP_000477989.1.57943 WP_000477989.1.57944 WP_000477989.1.57952 WP_000477989.1.57974 WP_000477989.1.58005 WP_000477989.1.58014 WP_000477989.1.58016 WP_000477989.1.58017 WP_000477989.1.58035 WP_000477989.1.58049 WP_000477989.1.58050 WP_000477989.1.58074 WP_000477989.1.58116 WP_000477989.1.58127 WP_000477989.1.58148 WP_000477989.1.58158 WP_000477989.1.5816 WP_000477989.1.58175 WP_000477989.1.58277 WP_000477989.1.58317 WP_000477989.1.58321 WP_000477989.1.58352 WP_000477989.1.58364 WP_000477989.1.58388 WP_000477989.1.58395 WP_000477989.1.58413 WP_000477989.1.58419 WP_000477989.1.58430 WP_000477989.1.58435 WP_000477989.1.58473 WP_000477989.1.58495 WP_000477989.1.58497 WP_000477989.1.58512 WP_000477989.1.58530 WP_000477989.1.58549 WP_000477989.1.5857 WP_000477989.1.58571 WP_000477989.1.58592 WP_000477989.1.58598 WP_000477989.1.58701 WP_000477989.1.58704 WP_000477989.1.58718 WP_000477989.1.58735 WP_000477989.1.58760 WP_000477989.1.58763 WP_000477989.1.58772 WP_000477989.1.58798 WP_000477989.1.5880 WP_000477989.1.58833 WP_000477989.1.58855 WP_000477989.1.58934 WP_000477989.1.58960 WP_000477989.1.58981 WP_000477989.1.58991 WP_000477989.1.59014 WP_000477989.1.59039 WP_000477989.1.59062 WP_000477989.1.59077 WP_000477989.1.59098 WP_000477989.1.59124 WP_000477989.1.59135 WP_000477989.1.59146 WP_000477989.1.59187 WP_000477989.1.5920 WP_000477989.1.59203 WP_000477989.1.59213 WP_000477989.1.59311 WP_000477989.1.59337 WP_000477989.1.5938 WP_000477989.1.59380 WP_000477989.1.59398 WP_000477989.1.5940 WP_000477989.1.59401 WP_000477989.1.59404 WP_000477989.1.59441 WP_000477989.1.59462 WP_000477989.1.59464 WP_000477989.1.59489 WP_000477989.1.59498 WP_000477989.1.59546 WP_000477989.1.59547 WP_000477989.1.59598 WP_000477989.1.59624 WP_000477989.1.59643 WP_000477989.1.59668 WP_000477989.1.59669 WP_000477989.1.59671 WP_000477989.1.5972 WP_000477989.1.59736 WP_000477989.1.59787 WP_000477989.1.5982 WP_000477989.1.59822 WP_000477989.1.59874 WP_000477989.1.59896 WP_000477989.1.59907 WP_000477989.1.59915 WP_000477989.1.59921 WP_000477989.1.59945 WP_000477989.1.60001 WP_000477989.1.60006 WP_000477989.1.6006 WP_000477989.1.60101 WP_000477989.1.60107 WP_000477989.1.60123 WP_000477989.1.60124 WP_000477989.1.60147 WP_000477989.1.60149 WP_000477989.1.60157 WP_000477989.1.6017 WP_000477989.1.60201 WP_000477989.1.60227 WP_000477989.1.60302 WP_000477989.1.6034 WP_000477989.1.60345 WP_000477989.1.60353 WP_000477989.1.60360 WP_000477989.1.60382 WP_000477989.1.60414 WP_000477989.1.60431 WP_000477989.1.60434 WP_000477989.1.60473 WP_000477989.1.60492 WP_000477989.1.60493 WP_000477989.1.60530 WP_000477989.1.60547 WP_000477989.1.60585 WP_000477989.1.60595 WP_000477989.1.60636 WP_000477989.1.60641 WP_000477989.1.60675 WP_000477989.1.60677 WP_000477989.1.60734 WP_000477989.1.60750 WP_000477989.1.60751 WP_000477989.1.60758 WP_000477989.1.60759 WP_000477989.1.60765 WP_000477989.1.60778 WP_000477989.1.60813 WP_000477989.1.60820 WP_000477989.1.60845 WP_000477989.1.6085 WP_000477989.1.60869 WP_000477989.1.60888 WP_000477989.1.60912 WP_000477989.1.60917 WP_000477989.1.60923 WP_000477989.1.60943 WP_000477989.1.60946 WP_000477989.1.60948 WP_000477989.1.60949 WP_000477989.1.60965 WP_000477989.1.60982 WP_000477989.1.60991 WP_000477989.1.61009 WP_000477989.1.61013 WP_000477989.1.61023 WP_000477989.1.61026 WP_000477989.1.61029 WP_000477989.1.61031 WP_000477989.1.61077 WP_000477989.1.61082 WP_000477989.1.61115 WP_000477989.1.61139 WP_000477989.1.61187 WP_000477989.1.61189 WP_000477989.1.6119 WP_000477989.1.61215 WP_000477989.1.6123 WP_000477989.1.61261 WP_000477989.1.61263 WP_000477989.1.61277 WP_000477989.1.61286 WP_000477989.1.61289 WP_000477989.1.61313 WP_000477989.1.61316 WP_000477989.1.61327 WP_000477989.1.6136 WP_000477989.1.61375 WP_000477989.1.61394 WP_000477989.1.61430 WP_000477989.1.61439 WP_000477989.1.61440 WP_000477989.1.61555 WP_000477989.1.61564 WP_000477989.1.61585 WP_000477989.1.61597 WP_000477989.1.61615 WP_000477989.1.61639 WP_000477989.1.61641 WP_000477989.1.6166 WP_000477989.1.61687 WP_000477989.1.6170 WP_000477989.1.61705 WP_000477989.1.61747 WP_000477989.1.61749 WP_000477989.1.61800 WP_000477989.1.61802 WP_000477989.1.61831 WP_000477989.1.61838 WP_000477989.1.61864 WP_000477989.1.6189 WP_000477989.1.61897 WP_000477989.1.61903 WP_000477989.1.61921 WP_000477989.1.61936 WP_000477989.1.61975 WP_000477989.1.61978 WP_000477989.1.62002 WP_000477989.1.6201 WP_000477989.1.62028 WP_000477989.1.62069 WP_000477989.1.62071 WP_000477989.1.6208 WP_000477989.1.62084 WP_000477989.1.62085 WP_000477989.1.62096 WP_000477989.1.62160 WP_000477989.1.62229 WP_000477989.1.62247 WP_000477989.1.62254 WP_000477989.1.62265 WP_000477989.1.6234 WP_000477989.1.62346 WP_000477989.1.62352 WP_000477989.1.62382 WP_000477989.1.62383 WP_000477989.1.62398 WP_000477989.1.62414 WP_000477989.1.62429 WP_000477989.1.62437 WP_000477989.1.62453 WP_000477989.1.62474 WP_000477989.1.62482 WP_000477989.1.62492 WP_000477989.1.62496 WP_000477989.1.6250 WP_000477989.1.62553 WP_000477989.1.62602 WP_000477989.1.62608 WP_000477989.1.62625 WP_000477989.1.62630 WP_000477989.1.62653 WP_000477989.1.62674 WP_000477989.1.6268 WP_000477989.1.62764 WP_000477989.1.62822 WP_000477989.1.62824 WP_000477989.1.62831 WP_000477989.1.62860 WP_000477989.1.62863 WP_000477989.1.62880 WP_000477989.1.62927 WP_000477989.1.62970 WP_000477989.1.62974 WP_000477989.1.6298 WP_000477989.1.62998 WP_000477989.1.63003 WP_000477989.1.63004 WP_000477989.1.63027 WP_000477989.1.63062 WP_000477989.1.63068 WP_000477989.1.63070 WP_000477989.1.63083 WP_000477989.1.63085 WP_000477989.1.63131 WP_000477989.1.63139 WP_000477989.1.63140 WP_000477989.1.63142 WP_000477989.1.63162 WP_000477989.1.63170 WP_000477989.1.63215 WP_000477989.1.63220 WP_000477989.1.63280 WP_000477989.1.63289 WP_000477989.1.63304 WP_000477989.1.63322 WP_000477989.1.63333 WP_000477989.1.63341 WP_000477989.1.63364 WP_000477989.1.63365 WP_000477989.1.634 WP_000477989.1.63441 WP_000477989.1.63469 WP_000477989.1.63471 WP_000477989.1.63673 WP_000477989.1.63678 WP_000477989.1.63726 WP_000477989.1.63729 WP_000477989.1.63751 WP_000477989.1.63759 WP_000477989.1.63760 WP_000477989.1.63774 WP_000477989.1.63828 WP_000477989.1.63878 WP_000477989.1.6388 WP_000477989.1.63907 WP_000477989.1.63910 WP_000477989.1.63937 WP_000477989.1.63947 WP_000477989.1.63975 WP_000477989.1.63987 WP_000477989.1.6403 WP_000477989.1.6408 WP_000477989.1.6412 WP_000477989.1.64192 WP_000477989.1.64230 WP_000477989.1.64250 WP_000477989.1.64279 WP_000477989.1.64334 WP_000477989.1.64351 WP_000477989.1.64367 WP_000477989.1.6438 WP_000477989.1.64397 WP_000477989.1.64400 WP_000477989.1.64440 WP_000477989.1.64456 WP_000477989.1.64457 WP_000477989.1.64525 WP_000477989.1.64549 WP_000477989.1.64565 WP_000477989.1.64583 WP_000477989.1.6459 WP_000477989.1.64630 WP_000477989.1.64631 WP_000477989.1.64677 WP_000477989.1.64686 WP_000477989.1.64720 WP_000477989.1.64765 WP_000477989.1.6479 WP_000477989.1.64873 WP_000477989.1.64879 WP_000477989.1.6488 WP_000477989.1.64893 WP_000477989.1.64896 WP_000477989.1.64897 WP_000477989.1.64899 WP_000477989.1.64928 WP_000477989.1.64935 WP_000477989.1.64961 WP_000477989.1.64994 WP_000477989.1.65033 WP_000477989.1.65044 WP_000477989.1.65046 WP_000477989.1.65082 WP_000477989.1.65125 WP_000477989.1.65132 WP_000477989.1.65153 WP_000477989.1.65156 WP_000477989.1.65158 WP_000477989.1.65180 WP_000477989.1.65193 WP_000477989.1.65214 WP_000477989.1.65217 WP_000477989.1.65243 WP_000477989.1.65259 WP_000477989.1.65361 WP_000477989.1.65367 WP_000477989.1.65419 WP_000477989.1.65423 WP_000477989.1.65432 WP_000477989.1.65443 WP_000477989.1.65451 WP_000477989.1.6547 WP_000477989.1.65470 WP_000477989.1.6551 WP_000477989.1.65520 WP_000477989.1.65541 WP_000477989.1.65544 WP_000477989.1.65555 WP_000477989.1.65562 WP_000477989.1.65600 WP_000477989.1.65653 WP_000477989.1.65663 WP_000477989.1.65675 WP_000477989.1.65689 WP_000477989.1.65693 WP_000477989.1.65700 WP_000477989.1.65703 WP_000477989.1.65750 WP_000477989.1.65752 WP_000477989.1.65808 WP_000477989.1.65842 WP_000477989.1.65856 WP_000477989.1.65922 WP_000477989.1.65931 WP_000477989.1.65948 WP_000477989.1.66009 WP_000477989.1.66035 WP_000477989.1.66056 WP_000477989.1.66081 WP_000477989.1.661 WP_000477989.1.6612 WP_000477989.1.66120 WP_000477989.1.66133 WP_000477989.1.66175 WP_000477989.1.66281 WP_000477989.1.66287 WP_000477989.1.66302 WP_000477989.1.66369 WP_000477989.1.66433 WP_000477989.1.66519 WP_000477989.1.66542 WP_000477989.1.66554 WP_000477989.1.66564 WP_000477989.1.66576 WP_000477989.1.66588 WP_000477989.1.66601 WP_000477989.1.66606 WP_000477989.1.6662 WP_000477989.1.66655 WP_000477989.1.66664 WP_000477989.1.66677 WP_000477989.1.66711 WP_000477989.1.66712 WP_000477989.1.6674 WP_000477989.1.66786 WP_000477989.1.66818 WP_000477989.1.6684 WP_000477989.1.66879 WP_000477989.1.66979 WP_000477989.1.6700 WP_000477989.1.67006 WP_000477989.1.67090 WP_000477989.1.67112 WP_000477989.1.67135 WP_000477989.1.67191 WP_000477989.1.67204 WP_000477989.1.6722 WP_000477989.1.67266 WP_000477989.1.67297 WP_000477989.1.67329 WP_000477989.1.67333 WP_000477989.1.67379 WP_000477989.1.67384 WP_000477989.1.67386 WP_000477989.1.6740 WP_000477989.1.67414 WP_000477989.1.67463 WP_000477989.1.67480 WP_000477989.1.67505 WP_000477989.1.67507 WP_000477989.1.67513 WP_000477989.1.67520 WP_000477989.1.67521 WP_000477989.1.67554 WP_000477989.1.67572 WP_000477989.1.67609 WP_000477989.1.67612 WP_000477989.1.67618 WP_000477989.1.67632 WP_000477989.1.67651 WP_000477989.1.67652 WP_000477989.1.67703 WP_000477989.1.67713 WP_000477989.1.67752 WP_000477989.1.67754 WP_000477989.1.67762 WP_000477989.1.67767 WP_000477989.1.67815 WP_000477989.1.6786 WP_000477989.1.67865 WP_000477989.1.67889 WP_000477989.1.67925 WP_000477989.1.67941 WP_000477989.1.67986 WP_000477989.1.68001 WP_000477989.1.68033 WP_000477989.1.68054 WP_000477989.1.68066 WP_000477989.1.68102 WP_000477989.1.6811 WP_000477989.1.68111 WP_000477989.1.68160 WP_000477989.1.68161 WP_000477989.1.68219 WP_000477989.1.68286 WP_000477989.1.68295 WP_000477989.1.68296 WP_000477989.1.6830 WP_000477989.1.68307 WP_000477989.1.6834 WP_000477989.1.68343 WP_000477989.1.68351 WP_000477989.1.68367 WP_000477989.1.6839 WP_000477989.1.68397 WP_000477989.1.68404 WP_000477989.1.68416 WP_000477989.1.68425 WP_000477989.1.68483 WP_000477989.1.68489 WP_000477989.1.68505 WP_000477989.1.68522 WP_000477989.1.68542 WP_000477989.1.68565 WP_000477989.1.68575 WP_000477989.1.68636 WP_000477989.1.68650 WP_000477989.1.68699 WP_000477989.1.68703 WP_000477989.1.68728 WP_000477989.1.68737 WP_000477989.1.68813 WP_000477989.1.68854 WP_000477989.1.68864 WP_000477989.1.68875 WP_000477989.1.68917 WP_000477989.1.68943 WP_000477989.1.68944 WP_000477989.1.69045 WP_000477989.1.69087 WP_000477989.1.69089 WP_000477989.1.691 WP_000477989.1.69110 WP_000477989.1.69111 WP_000477989.1.69125 WP_000477989.1.69147 WP_000477989.1.6917 WP_000477989.1.69179 WP_000477989.1.69191 WP_000477989.1.69219 WP_000477989.1.69222 WP_000477989.1.69232 WP_000477989.1.69237 WP_000477989.1.69251 WP_000477989.1.69280 WP_000477989.1.69314 WP_000477989.1.69361 WP_000477989.1.69366 WP_000477989.1.69378 WP_000477989.1.69395 WP_000477989.1.69415 WP_000477989.1.69446 WP_000477989.1.69476 WP_000477989.1.69477 WP_000477989.1.69480 WP_000477989.1.69484 WP_000477989.1.695 WP_000477989.1.6953 WP_000477989.1.69552 WP_000477989.1.69559 WP_000477989.1.69563 WP_000477989.1.69622 WP_000477989.1.69679 WP_000477989.1.69685 WP_000477989.1.69718 WP_000477989.1.69842 WP_000477989.1.69877 WP_000477989.1.69878 WP_000477989.1.69921 WP_000477989.1.69987 WP_000477989.1.70024 WP_000477989.1.70048 WP_000477989.1.70105 WP_000477989.1.7012 WP_000477989.1.70133 WP_000477989.1.70210 WP_000477989.1.7024 WP_000477989.1.70253 WP_000477989.1.70273 WP_000477989.1.7030 WP_000477989.1.70338 WP_000477989.1.7034 WP_000477989.1.70344 WP_000477989.1.70349 WP_000477989.1.70353 WP_000477989.1.70361 WP_000477989.1.70389 WP_000477989.1.7043 WP_000477989.1.70438 WP_000477989.1.70451 WP_000477989.1.70459 WP_000477989.1.70462 WP_000477989.1.7053 WP_000477989.1.70546 WP_000477989.1.70572 WP_000477989.1.7061 WP_000477989.1.70611 WP_000477989.1.70641 WP_000477989.1.70651 WP_000477989.1.7067 WP_000477989.1.7071 WP_000477989.1.7073 WP_000477989.1.70790 WP_000477989.1.70791 WP_000477989.1.70818 WP_000477989.1.70823 WP_000477989.1.70829 WP_000477989.1.70855 WP_000477989.1.7089 WP_000477989.1.70917 WP_000477989.1.70924 WP_000477989.1.70930 WP_000477989.1.70939 WP_000477989.1.70943 WP_000477989.1.71043 WP_000477989.1.71058 WP_000477989.1.71059 WP_000477989.1.71073 WP_000477989.1.7109 WP_000477989.1.711 WP_000477989.1.71130 WP_000477989.1.71143 WP_000477989.1.71180 WP_000477989.1.71196 WP_000477989.1.7120 WP_000477989.1.71236 WP_000477989.1.7125 WP_000477989.1.71256 WP_000477989.1.71257 WP_000477989.1.71295 WP_000477989.1.71298 WP_000477989.1.71325 WP_000477989.1.71332 WP_000477989.1.71345 WP_000477989.1.71351 WP_000477989.1.71359 WP_000477989.1.71419 WP_000477989.1.71431 WP_000477989.1.71463 WP_000477989.1.7150 WP_000477989.1.71519 WP_000477989.1.71521 WP_000477989.1.71529 WP_000477989.1.71543 WP_000477989.1.71590 WP_000477989.1.71596 WP_000477989.1.71602 WP_000477989.1.7161 WP_000477989.1.71644 WP_000477989.1.71662 WP_000477989.1.71676 WP_000477989.1.71735 WP_000477989.1.71772 WP_000477989.1.71780 WP_000477989.1.71788 WP_000477989.1.7179 WP_000477989.1.71859 WP_000477989.1.71861 WP_000477989.1.71888 WP_000477989.1.71925 WP_000477989.1.71949 WP_000477989.1.7198 WP_000477989.1.71989 WP_000477989.1.72031 WP_000477989.1.72035 WP_000477989.1.72067 WP_000477989.1.72089 WP_000477989.1.72099 WP_000477989.1.72112 WP_000477989.1.72169 WP_000477989.1.72176 WP_000477989.1.72205 WP_000477989.1.72271 WP_000477989.1.72330 WP_000477989.1.72347 WP_000477989.1.7236 WP_000477989.1.72366 WP_000477989.1.7242 WP_000477989.1.72424 WP_000477989.1.72433 WP_000477989.1.72547 WP_000477989.1.72564 WP_000477989.1.72626 WP_000477989.1.72654 WP_000477989.1.72750 WP_000477989.1.7278 WP_000477989.1.72787 WP_000477989.1.72832 WP_000477989.1.72835 WP_000477989.1.72903 WP_000477989.1.72904 WP_000477989.1.7292 WP_000477989.1.72935 WP_000477989.1.72945 WP_000477989.1.72965 WP_000477989.1.73004 WP_000477989.1.73017 WP_000477989.1.73019 WP_000477989.1.73022 WP_000477989.1.73037 WP_000477989.1.73074 WP_000477989.1.73122 WP_000477989.1.73132 WP_000477989.1.73246 WP_000477989.1.73265 WP_000477989.1.73286 WP_000477989.1.73312 WP_000477989.1.73386 WP_000477989.1.73456 WP_000477989.1.73467 WP_000477989.1.73501 WP_000477989.1.73526 WP_000477989.1.73591 WP_000477989.1.736 WP_000477989.1.73639 WP_000477989.1.73693 WP_000477989.1.73733 WP_000477989.1.73735 WP_000477989.1.73736 WP_000477989.1.73759 WP_000477989.1.73786 WP_000477989.1.7380 WP_000477989.1.73834 WP_000477989.1.73858 WP_000477989.1.73868 WP_000477989.1.73880 WP_000477989.1.73910 WP_000477989.1.73920 WP_000477989.1.73961 WP_000477989.1.73969 WP_000477989.1.73976 WP_000477989.1.73983 WP_000477989.1.74006 WP_000477989.1.74010 WP_000477989.1.74013 WP_000477989.1.74027 WP_000477989.1.74081 WP_000477989.1.74088 WP_000477989.1.74155 WP_000477989.1.74157 WP_000477989.1.74158 WP_000477989.1.74161 WP_000477989.1.74172 WP_000477989.1.74173 WP_000477989.1.7418 WP_000477989.1.74183 WP_000477989.1.74187 WP_000477989.1.74201 WP_000477989.1.74216 WP_000477989.1.74234 WP_000477989.1.74237 WP_000477989.1.74242 WP_000477989.1.7427 WP_000477989.1.74273 WP_000477989.1.7428 WP_000477989.1.74338 WP_000477989.1.7434 WP_000477989.1.74353 WP_000477989.1.74356 WP_000477989.1.74380 WP_000477989.1.74429 WP_000477989.1.74457 WP_000477989.1.74486 WP_000477989.1.74556 WP_000477989.1.7457 WP_000477989.1.74587 WP_000477989.1.74638 WP_000477989.1.74693 WP_000477989.1.74696 WP_000477989.1.74704 WP_000477989.1.74731 WP_000477989.1.74747 WP_000477989.1.74761 WP_000477989.1.74781 WP_000477989.1.74802 WP_000477989.1.74846 WP_000477989.1.74849 WP_000477989.1.74866 WP_000477989.1.74899 WP_000477989.1.74911 WP_000477989.1.74922 WP_000477989.1.74924 WP_000477989.1.74961 WP_000477989.1.74963 WP_000477989.1.74978 WP_000477989.1.74994 WP_000477989.1.74999 WP_000477989.1.7500 WP_000477989.1.75006 WP_000477989.1.75038 WP_000477989.1.75044 WP_000477989.1.75052 WP_000477989.1.75091 WP_000477989.1.75093 WP_000477989.1.75122 WP_000477989.1.75141 WP_000477989.1.75186 WP_000477989.1.75227 WP_000477989.1.75252 WP_000477989.1.75253 WP_000477989.1.75294 WP_000477989.1.75298 WP_000477989.1.75320 WP_000477989.1.75327 WP_000477989.1.75349 WP_000477989.1.75365 WP_000477989.1.75369 WP_000477989.1.75379 WP_000477989.1.75399 WP_000477989.1.75411 WP_000477989.1.7542 WP_000477989.1.75438 WP_000477989.1.75440 WP_000477989.1.75481 WP_000477989.1.75506 WP_000477989.1.75509 WP_000477989.1.75527 WP_000477989.1.75542 WP_000477989.1.75551 WP_000477989.1.7561 WP_000477989.1.75623 WP_000477989.1.75649 WP_000477989.1.75652 WP_000477989.1.75680 WP_000477989.1.75685 WP_000477989.1.75769 WP_000477989.1.75770 WP_000477989.1.75775 WP_000477989.1.75824 WP_000477989.1.75830 WP_000477989.1.7584 WP_000477989.1.75848 WP_000477989.1.75856 WP_000477989.1.75879 WP_000477989.1.75881 WP_000477989.1.75885 WP_000477989.1.75929 WP_000477989.1.75952 WP_000477989.1.7596 WP_000477989.1.75969 WP_000477989.1.76010 WP_000477989.1.76015 WP_000477989.1.76071 WP_000477989.1.76073 WP_000477989.1.76095 WP_000477989.1.76112 WP_000477989.1.76136 WP_000477989.1.76143 WP_000477989.1.76149 WP_000477989.1.76185 WP_000477989.1.76230 WP_000477989.1.76234 WP_000477989.1.7625 WP_000477989.1.76258 WP_000477989.1.76261 WP_000477989.1.76282 WP_000477989.1.76283 WP_000477989.1.76294 WP_000477989.1.76323 WP_000477989.1.76332 WP_000477989.1.76333 WP_000477989.1.76337 WP_000477989.1.76351 WP_000477989.1.7638 WP_000477989.1.76411 WP_000477989.1.76419 WP_000477989.1.76420 WP_000477989.1.76421 WP_000477989.1.76482 WP_000477989.1.765 WP_000477989.1.76528 WP_000477989.1.7658 WP_000477989.1.76604 WP_000477989.1.76606 WP_000477989.1.76624 WP_000477989.1.76648 WP_000477989.1.76686 WP_000477989.1.76693 WP_000477989.1.7675 WP_000477989.1.76790 WP_000477989.1.76792 WP_000477989.1.76816 WP_000477989.1.76825 WP_000477989.1.76839 WP_000477989.1.7686 WP_000477989.1.76867 WP_000477989.1.76878 WP_000477989.1.76897 WP_000477989.1.76921 WP_000477989.1.76944 WP_000477989.1.76952 WP_000477989.1.76998 WP_000477989.1.77013 WP_000477989.1.77020 WP_000477989.1.77027 WP_000477989.1.77031 WP_000477989.1.77041 WP_000477989.1.77050 WP_000477989.1.77060 WP_000477989.1.77062 WP_000477989.1.77112 WP_000477989.1.77176 WP_000477989.1.77256 WP_000477989.1.77259 WP_000477989.1.77305 WP_000477989.1.77354 WP_000477989.1.77426 WP_000477989.1.77446 WP_000477989.1.7745 WP_000477989.1.7746 WP_000477989.1.77485 WP_000477989.1.77489 WP_000477989.1.77497 WP_000477989.1.7752 WP_000477989.1.77520 WP_000477989.1.77527 WP_000477989.1.77533 WP_000477989.1.77536 WP_000477989.1.77572 WP_000477989.1.77606 WP_000477989.1.77674 WP_000477989.1.77733 WP_000477989.1.77738 WP_000477989.1.7774 WP_000477989.1.77743 WP_000477989.1.77745 WP_000477989.1.77763 WP_000477989.1.77805 WP_000477989.1.77818 WP_000477989.1.77822 WP_000477989.1.77827 WP_000477989.1.77832 WP_000477989.1.77848 WP_000477989.1.77858 WP_000477989.1.7787 WP_000477989.1.77896 WP_000477989.1.77908 WP_000477989.1.77952 WP_000477989.1.77957 WP_000477989.1.78002 WP_000477989.1.78050 WP_000477989.1.78054 WP_000477989.1.78091 WP_000477989.1.78095 WP_000477989.1.7810 WP_000477989.1.78126 WP_000477989.1.78173 WP_000477989.1.78185 WP_000477989.1.78189 WP_000477989.1.78207 WP_000477989.1.78208 WP_000477989.1.78252 WP_000477989.1.78254 WP_000477989.1.78257 WP_000477989.1.7827 WP_000477989.1.78311 WP_000477989.1.7833 WP_000477989.1.78332 WP_000477989.1.78365 WP_000477989.1.78392 WP_000477989.1.78404 WP_000477989.1.78458 WP_000477989.1.7850 WP_000477989.1.78550 WP_000477989.1.78558 WP_000477989.1.7857 WP_000477989.1.78582 WP_000477989.1.78596 WP_000477989.1.78598 WP_000477989.1.78604 WP_000477989.1.78625 WP_000477989.1.78633 WP_000477989.1.78653 WP_000477989.1.78667 WP_000477989.1.7868 WP_000477989.1.78708 WP_000477989.1.78728 WP_000477989.1.78785 WP_000477989.1.78803 WP_000477989.1.78819 WP_000477989.1.78841 WP_000477989.1.78872 WP_000477989.1.7888 WP_000477989.1.78897 WP_000477989.1.78934 WP_000477989.1.78946 WP_000477989.1.78983 WP_000477989.1.78985 WP_000477989.1.7900 WP_000477989.1.79006 WP_000477989.1.79037 WP_000477989.1.79038 WP_000477989.1.79051 WP_000477989.1.79085 WP_000477989.1.79114 WP_000477989.1.79131 WP_000477989.1.79170 WP_000477989.1.79197 WP_000477989.1.79208 WP_000477989.1.79223 WP_000477989.1.79227 WP_000477989.1.79244 WP_000477989.1.79270 WP_000477989.1.7931 WP_000477989.1.79310 WP_000477989.1.79314 WP_000477989.1.79320 WP_000477989.1.79322 WP_000477989.1.79332 WP_000477989.1.79334 WP_000477989.1.79341 WP_000477989.1.79367 WP_000477989.1.79374 WP_000477989.1.79379 WP_000477989.1.79402 WP_000477989.1.79408 WP_000477989.1.79436 WP_000477989.1.79461 WP_000477989.1.79473 WP_000477989.1.79476 WP_000477989.1.79487 WP_000477989.1.79539 WP_000477989.1.79543 WP_000477989.1.79556 WP_000477989.1.79626 WP_000477989.1.79638 WP_000477989.1.79646 WP_000477989.1.79662 WP_000477989.1.79664 WP_000477989.1.79676 WP_000477989.1.79706 WP_000477989.1.79810 WP_000477989.1.79822 WP_000477989.1.79831 WP_000477989.1.79834 WP_000477989.1.79837 WP_000477989.1.79855 WP_000477989.1.7989 WP_000477989.1.79896 WP_000477989.1.79919 WP_000477989.1.79961 WP_000477989.1.79971 WP_000477989.1.79991 WP_000477989.1.80000 WP_000477989.1.80032 WP_000477989.1.80034 WP_000477989.1.80042 WP_000477989.1.80079 WP_000477989.1.80109 WP_000477989.1.80127 WP_000477989.1.80147 WP_000477989.1.80159 WP_000477989.1.80203 WP_000477989.1.80206 WP_000477989.1.80287 WP_000477989.1.80290 WP_000477989.1.80297 WP_000477989.1.80303 WP_000477989.1.8031 WP_000477989.1.80318 WP_000477989.1.8035 WP_000477989.1.80358 WP_000477989.1.80378 WP_000477989.1.80414 WP_000477989.1.8043 WP_000477989.1.80472 WP_000477989.1.80482 WP_000477989.1.80530 WP_000477989.1.8065 WP_000477989.1.80653 WP_000477989.1.8066 WP_000477989.1.80687 WP_000477989.1.80717 WP_000477989.1.80734 WP_000477989.1.80761 WP_000477989.1.80763 WP_000477989.1.80781 WP_000477989.1.80786 WP_000477989.1.80793 WP_000477989.1.80801 WP_000477989.1.80828 WP_000477989.1.80833 WP_000477989.1.8084 WP_000477989.1.8085 WP_000477989.1.80855 WP_000477989.1.80872 WP_000477989.1.80962 WP_000477989.1.80979 WP_000477989.1.80980 WP_000477989.1.81010 WP_000477989.1.81085 WP_000477989.1.81092 WP_000477989.1.81114 WP_000477989.1.81157 WP_000477989.1.81171 WP_000477989.1.81234 WP_000477989.1.8125 WP_000477989.1.81252 WP_000477989.1.81344 WP_000477989.1.8135 WP_000477989.1.81384 WP_000477989.1.81385 WP_000477989.1.81389 WP_000477989.1.8142 WP_000477989.1.81436 WP_000477989.1.8144 WP_000477989.1.81467 WP_000477989.1.81549 WP_000477989.1.81572 WP_000477989.1.81599 WP_000477989.1.81610 WP_000477989.1.81631 WP_000477989.1.81637 WP_000477989.1.81734 WP_000477989.1.81740 WP_000477989.1.81758 WP_000477989.1.8176 WP_000477989.1.81800 WP_000477989.1.81810 WP_000477989.1.81812 WP_000477989.1.81831 WP_000477989.1.81861 WP_000477989.1.81870 WP_000477989.1.8188 WP_000477989.1.81897 WP_000477989.1.81903 WP_000477989.1.81904 WP_000477989.1.81905 WP_000477989.1.81906 WP_000477989.1.81919 WP_000477989.1.81940 WP_000477989.1.81944 WP_000477989.1.81955 WP_000477989.1.81996 WP_000477989.1.81999 WP_000477989.1.82009 WP_000477989.1.82015 WP_000477989.1.82053 WP_000477989.1.8212 WP_000477989.1.82121 WP_000477989.1.82161 WP_000477989.1.82167 WP_000477989.1.82219 WP_000477989.1.82247 WP_000477989.1.82259 WP_000477989.1.82278 WP_000477989.1.82340 WP_000477989.1.82354 WP_000477989.1.82358 WP_000477989.1.8244 WP_000477989.1.82447 WP_000477989.1.8246 WP_000477989.1.82467 WP_000477989.1.82548 WP_000477989.1.82612 WP_000477989.1.8265 WP_000477989.1.82709 WP_000477989.1.82724 WP_000477989.1.82760 WP_000477989.1.82762 WP_000477989.1.82796 WP_000477989.1.8280 WP_000477989.1.82829 WP_000477989.1.82835 WP_000477989.1.82862 WP_000477989.1.8289 WP_000477989.1.82916 WP_000477989.1.82931 WP_000477989.1.82976 WP_000477989.1.82980 WP_000477989.1.82984 WP_000477989.1.82997 WP_000477989.1.83011 WP_000477989.1.83013 WP_000477989.1.83050 WP_000477989.1.83053 WP_000477989.1.83066 WP_000477989.1.83152 WP_000477989.1.83153 WP_000477989.1.83185 WP_000477989.1.83234 WP_000477989.1.83243 WP_000477989.1.8328 WP_000477989.1.83316 WP_000477989.1.83352 WP_000477989.1.83372 WP_000477989.1.83416 WP_000477989.1.83418 WP_000477989.1.83475 WP_000477989.1.83476 WP_000477989.1.83484 WP_000477989.1.83508 WP_000477989.1.83517 WP_000477989.1.83592 WP_000477989.1.83593 WP_000477989.1.83624 WP_000477989.1.83626 WP_000477989.1.83645 WP_000477989.1.83646 WP_000477989.1.83653 WP_000477989.1.83714 WP_000477989.1.83763 WP_000477989.1.83769 WP_000477989.1.83770 WP_000477989.1.83775 WP_000477989.1.83778 WP_000477989.1.8383 WP_000477989.1.83837 WP_000477989.1.83852 WP_000477989.1.83864 WP_000477989.1.83865 WP_000477989.1.83868 WP_000477989.1.83881 WP_000477989.1.83902 WP_000477989.1.83905 WP_000477989.1.83912 WP_000477989.1.83917 WP_000477989.1.83919 WP_000477989.1.83925 WP_000477989.1.83928 WP_000477989.1.83935 WP_000477989.1.83955 WP_000477989.1.83984 WP_000477989.1.84010 WP_000477989.1.84041 WP_000477989.1.84049 WP_000477989.1.84064 WP_000477989.1.84067 WP_000477989.1.84068 WP_000477989.1.84144 WP_000477989.1.84163 WP_000477989.1.84284 WP_000477989.1.84293 WP_000477989.1.84322 WP_000477989.1.84342 WP_000477989.1.84414 WP_000477989.1.84416 WP_000477989.1.84442 WP_000477989.1.84445 WP_000477989.1.84451 WP_000477989.1.84508 WP_000477989.1.84509 WP_000477989.1.84555 WP_000477989.1.84563 WP_000477989.1.84570 WP_000477989.1.84578 WP_000477989.1.84602 WP_000477989.1.84612 WP_000477989.1.84625 WP_000477989.1.84630 WP_000477989.1.84638 WP_000477989.1.84652 WP_000477989.1.84662 WP_000477989.1.8468 WP_000477989.1.84682 WP_000477989.1.8475 WP_000477989.1.84752 WP_000477989.1.84757 WP_000477989.1.84761 WP_000477989.1.84815 WP_000477989.1.84844 WP_000477989.1.84889 WP_000477989.1.84903 WP_000477989.1.84907 WP_000477989.1.84922 WP_000477989.1.8493 WP_000477989.1.84943 WP_000477989.1.85022 WP_000477989.1.85047 WP_000477989.1.85056 WP_000477989.1.85083 WP_000477989.1.85099 WP_000477989.1.851 WP_000477989.1.85135 WP_000477989.1.85144 WP_000477989.1.85151 WP_000477989.1.85160 WP_000477989.1.85213 WP_000477989.1.85224 WP_000477989.1.85226 WP_000477989.1.85235 WP_000477989.1.85292 WP_000477989.1.85294 WP_000477989.1.85297 WP_000477989.1.85302 WP_000477989.1.85351 WP_000477989.1.85383 WP_000477989.1.85395 WP_000477989.1.85404 WP_000477989.1.85440 WP_000477989.1.85445 WP_000477989.1.85455 WP_000477989.1.85462 WP_000477989.1.85471 WP_000477989.1.85474 WP_000477989.1.85492 WP_000477989.1.85506 WP_000477989.1.8551 WP_000477989.1.85515 WP_000477989.1.85519 WP_000477989.1.85542 WP_000477989.1.85547 WP_000477989.1.85586 WP_000477989.1.85607 WP_000477989.1.85649 WP_000477989.1.85678 WP_000477989.1.85705 WP_000477989.1.8572 WP_000477989.1.85758 WP_000477989.1.8576 WP_000477989.1.85795 WP_000477989.1.85796 WP_000477989.1.85809 WP_000477989.1.85816 WP_000477989.1.85834 WP_000477989.1.85844 WP_000477989.1.85927 WP_000477989.1.85950 WP_000477989.1.85989 WP_000477989.1.85993 WP_000477989.1.86018 WP_000477989.1.86072 WP_000477989.1.8609 WP_000477989.1.86101 WP_000477989.1.86106 WP_000477989.1.86123 WP_000477989.1.86144 WP_000477989.1.86154 WP_000477989.1.86158 WP_000477989.1.8617 WP_000477989.1.86178 WP_000477989.1.86207 WP_000477989.1.86248 WP_000477989.1.86256 WP_000477989.1.8627 WP_000477989.1.86270 WP_000477989.1.86304 WP_000477989.1.86344 WP_000477989.1.86367 WP_000477989.1.86378 WP_000477989.1.8643 WP_000477989.1.86439 WP_000477989.1.86482 WP_000477989.1.86505 WP_000477989.1.86523 WP_000477989.1.86526 WP_000477989.1.86542 WP_000477989.1.86606 WP_000477989.1.86628 WP_000477989.1.86629 WP_000477989.1.86706 WP_000477989.1.86754 WP_000477989.1.86792 WP_000477989.1.8681 WP_000477989.1.86838 WP_000477989.1.86881 WP_000477989.1.86910 WP_000477989.1.86940 WP_000477989.1.86942 WP_000477989.1.86955 WP_000477989.1.86961 WP_000477989.1.86977 WP_000477989.1.87021 WP_000477989.1.87022 WP_000477989.1.87042 WP_000477989.1.87057 WP_000477989.1.87072 WP_000477989.1.87090 WP_000477989.1.87119 WP_000477989.1.8712 WP_000477989.1.87122 WP_000477989.1.87141 WP_000477989.1.87175 WP_000477989.1.87194 WP_000477989.1.8720 WP_000477989.1.87250 WP_000477989.1.87260 WP_000477989.1.87261 WP_000477989.1.87263 WP_000477989.1.87264 WP_000477989.1.87272 WP_000477989.1.87285 WP_000477989.1.87290 WP_000477989.1.8731 WP_000477989.1.87378 WP_000477989.1.87391 WP_000477989.1.87396 WP_000477989.1.87397 WP_000477989.1.87425 WP_000477989.1.87434 WP_000477989.1.87457 WP_000477989.1.87461 WP_000477989.1.87466 WP_000477989.1.87475 WP_000477989.1.87498 WP_000477989.1.875 WP_000477989.1.87502 WP_000477989.1.87508 WP_000477989.1.87515 WP_000477989.1.8753 WP_000477989.1.87543 WP_000477989.1.87601 WP_000477989.1.87623 WP_000477989.1.87710 WP_000477989.1.87718 WP_000477989.1.87740 WP_000477989.1.87748 WP_000477989.1.87764 WP_000477989.1.87782 WP_000477989.1.8779 WP_000477989.1.87802 WP_000477989.1.87808 WP_000477989.1.87828 WP_000477989.1.87838 WP_000477989.1.87879 WP_000477989.1.8791 WP_000477989.1.87912 WP_000477989.1.87943 WP_000477989.1.87963 WP_000477989.1.87964 WP_000477989.1.87972 WP_000477989.1.87995 WP_000477989.1.88013 WP_000477989.1.88032 WP_000477989.1.88061 WP_000477989.1.88150 WP_000477989.1.88166 WP_000477989.1.8820 WP_000477989.1.88270 WP_000477989.1.88279 WP_000477989.1.88317 WP_000477989.1.88319 WP_000477989.1.88328 WP_000477989.1.88348 WP_000477989.1.88351 WP_000477989.1.88367 WP_000477989.1.88371 WP_000477989.1.88373 WP_000477989.1.88395 WP_000477989.1.88471 WP_000477989.1.88473 WP_000477989.1.88480 WP_000477989.1.88498 WP_000477989.1.88518 WP_000477989.1.88555 WP_000477989.1.88558 WP_000477989.1.88560 WP_000477989.1.8857 WP_000477989.1.88580 WP_000477989.1.88599 WP_000477989.1.88623 WP_000477989.1.88636 WP_000477989.1.88642 WP_000477989.1.88671 WP_000477989.1.88694 WP_000477989.1.8872 WP_000477989.1.88739 WP_000477989.1.88753 WP_000477989.1.88761 WP_000477989.1.88827 WP_000477989.1.88856 WP_000477989.1.88859 WP_000477989.1.8886 WP_000477989.1.88861 WP_000477989.1.88871 WP_000477989.1.88874 WP_000477989.1.8888 WP_000477989.1.88897 WP_000477989.1.88912 WP_000477989.1.88934 WP_000477989.1.88987 WP_000477989.1.8899 WP_000477989.1.8900 WP_000477989.1.89070 WP_000477989.1.89086 WP_000477989.1.89103 WP_000477989.1.8913 WP_000477989.1.89173 WP_000477989.1.89181 WP_000477989.1.89194 WP_000477989.1.89195 WP_000477989.1.89204 WP_000477989.1.89229 WP_000477989.1.89235 WP_000477989.1.89237 WP_000477989.1.89258 WP_000477989.1.89284 WP_000477989.1.89347 WP_000477989.1.89414 WP_000477989.1.89516 WP_000477989.1.8953 WP_000477989.1.89537 WP_000477989.1.89544 WP_000477989.1.89545 WP_000477989.1.89559 WP_000477989.1.89628 WP_000477989.1.89651 WP_000477989.1.89655 WP_000477989.1.89672 WP_000477989.1.897 WP_000477989.1.89715 WP_000477989.1.89726 WP_000477989.1.89730 WP_000477989.1.89754 WP_000477989.1.89857 WP_000477989.1.89860 WP_000477989.1.89883 WP_000477989.1.89933 WP_000477989.1.89935 WP_000477989.1.89960 WP_000477989.1.90005 WP_000477989.1.90018 WP_000477989.1.90038 WP_000477989.1.90046 WP_000477989.1.90091 WP_000477989.1.90112 WP_000477989.1.90131 WP_000477989.1.90148 WP_000477989.1.90161 WP_000477989.1.90180 WP_000477989.1.90215 WP_000477989.1.9022 WP_000477989.1.90232 WP_000477989.1.90243 WP_000477989.1.90244 WP_000477989.1.90253 WP_000477989.1.90276 WP_000477989.1.9030 WP_000477989.1.90331 WP_000477989.1.90367 WP_000477989.1.90432 WP_000477989.1.90473 WP_000477989.1.90517 WP_000477989.1.90544 WP_000477989.1.90548 WP_000477989.1.9055 WP_000477989.1.90554 WP_000477989.1.90562 WP_000477989.1.90604 WP_000477989.1.90647 WP_000477989.1.90660 WP_000477989.1.90683 WP_000477989.1.9071 WP_000477989.1.90717 WP_000477989.1.90726 WP_000477989.1.90738 WP_000477989.1.9074 WP_000477989.1.90745 WP_000477989.1.90777 WP_000477989.1.90801 WP_000477989.1.90804 WP_000477989.1.90861 WP_000477989.1.90875 WP_000477989.1.90887 WP_000477989.1.90896 WP_000477989.1.90903 WP_000477989.1.90923 WP_000477989.1.90928 WP_000477989.1.9100 WP_000477989.1.91011 WP_000477989.1.91054 WP_000477989.1.91087 WP_000477989.1.91089 WP_000477989.1.91124 WP_000477989.1.91126 WP_000477989.1.9114 WP_000477989.1.91158 WP_000477989.1.91177 WP_000477989.1.912 WP_000477989.1.91233 WP_000477989.1.91246 WP_000477989.1.91252 WP_000477989.1.91258 WP_000477989.1.9127 WP_000477989.1.9130 WP_000477989.1.91300 WP_000477989.1.91310 WP_000477989.1.91316 WP_000477989.1.91332 WP_000477989.1.91346 WP_000477989.1.91357 WP_000477989.1.91364 WP_000477989.1.91365 WP_000477989.1.91380 WP_000477989.1.91382 WP_000477989.1.9140 WP_000477989.1.91420 WP_000477989.1.91427 WP_000477989.1.91465 WP_000477989.1.91487 WP_000477989.1.91500 WP_000477989.1.91501 WP_000477989.1.91542 WP_000477989.1.91547 WP_000477989.1.91559 WP_000477989.1.91581 WP_000477989.1.91587 WP_000477989.1.91591 WP_000477989.1.91635 WP_000477989.1.91639 WP_000477989.1.91749 WP_000477989.1.91771 WP_000477989.1.91781 WP_000477989.1.91791 WP_000477989.1.91800 WP_000477989.1.91816 WP_000477989.1.91829 WP_000477989.1.91895 WP_000477989.1.91911 WP_000477989.1.91928 WP_000477989.1.91950 WP_000477989.1.91955 WP_000477989.1.92 WP_000477989.1.92057 WP_000477989.1.92080 WP_000477989.1.92104 WP_000477989.1.92110 WP_000477989.1.92133 WP_000477989.1.92140 WP_000477989.1.92143 WP_000477989.1.92158 WP_000477989.1.92164 WP_000477989.1.92169 WP_000477989.1.92173 WP_000477989.1.92185 WP_000477989.1.92196 WP_000477989.1.92218 WP_000477989.1.92227 WP_000477989.1.9224 WP_000477989.1.92253 WP_000477989.1.92254 WP_000477989.1.92278 WP_000477989.1.923 WP_000477989.1.92324 WP_000477989.1.9234 WP_000477989.1.9239 WP_000477989.1.92398 WP_000477989.1.92415 WP_000477989.1.92424 WP_000477989.1.92436 WP_000477989.1.92442 WP_000477989.1.92479 WP_000477989.1.92488 WP_000477989.1.92497 WP_000477989.1.92500 WP_000477989.1.92520 WP_000477989.1.92534 WP_000477989.1.92560 WP_000477989.1.92565 WP_000477989.1.92607 WP_000477989.1.92679 WP_000477989.1.92691 WP_000477989.1.92723 WP_000477989.1.92726 WP_000477989.1.92735 WP_000477989.1.92741 WP_000477989.1.92772 WP_000477989.1.92773 WP_000477989.1.92778 WP_000477989.1.92789 WP_000477989.1.92805 WP_000477989.1.92840 WP_000477989.1.92848 WP_000477989.1.92862 WP_000477989.1.92864 WP_000477989.1.92918 WP_000477989.1.9293 WP_000477989.1.92937 WP_000477989.1.92950 WP_000477989.1.92960 WP_000477989.1.93010 WP_000477989.1.9305 WP_000477989.1.93074 WP_000477989.1.93078 WP_000477989.1.93125 WP_000477989.1.93141 WP_000477989.1.93163 WP_000477989.1.93176 WP_000477989.1.93191 WP_000477989.1.93207 WP_000477989.1.93211 WP_000477989.1.93224 WP_000477989.1.93237 WP_000477989.1.93251 WP_000477989.1.93296 WP_000477989.1.93300 WP_000477989.1.93310 WP_000477989.1.93329 WP_000477989.1.93336 WP_000477989.1.93416 WP_000477989.1.93438 WP_000477989.1.93444 WP_000477989.1.9346 WP_000477989.1.93514 WP_000477989.1.9352 WP_000477989.1.9354 WP_000477989.1.93561 WP_000477989.1.9358 WP_000477989.1.93590 WP_000477989.1.93613 WP_000477989.1.93658 WP_000477989.1.93678 WP_000477989.1.93710 WP_000477989.1.93722 WP_000477989.1.93736 WP_000477989.1.93738 WP_000477989.1.93769 WP_000477989.1.93787 WP_000477989.1.93862 WP_000477989.1.9387 WP_000477989.1.93882 WP_000477989.1.93883 WP_000477989.1.93891 WP_000477989.1.93934 WP_000477989.1.93972 WP_000477989.1.93976 WP_000477989.1.9398 WP_000477989.1.93981 WP_000477989.1.94009 WP_000477989.1.94016 WP_000477989.1.94060 WP_000477989.1.94074 WP_000477989.1.9408 WP_000477989.1.94082 WP_000477989.1.94087 WP_000477989.1.94096 WP_000477989.1.9411 WP_000477989.1.94114 WP_000477989.1.94119 WP_000477989.1.94165 WP_000477989.1.94172 WP_000477989.1.94294 WP_000477989.1.94335 WP_000477989.1.94340 WP_000477989.1.94345 WP_000477989.1.9435 WP_000477989.1.9437 WP_000477989.1.94374 WP_000477989.1.94375 WP_000477989.1.94376 WP_000477989.1.94389 WP_000477989.1.94409 WP_000477989.1.94414 WP_000477989.1.94530 WP_000477989.1.94549 WP_000477989.1.94550 WP_000477989.1.94576 WP_000477989.1.94636 WP_000477989.1.9464 WP_000477989.1.94641 WP_000477989.1.94688 WP_000477989.1.94733 WP_000477989.1.94741 WP_000477989.1.94789 WP_000477989.1.94797 WP_000477989.1.94844 WP_000477989.1.94845 WP_000477989.1.9485 WP_000477989.1.94857 WP_000477989.1.94866 WP_000477989.1.94941 WP_000477989.1.9495 WP_000477989.1.94958 WP_000477989.1.9497 WP_000477989.1.94980 WP_000477989.1.94989 WP_000477989.1.94999 WP_000477989.1.95014 WP_000477989.1.95038 WP_000477989.1.95049 WP_000477989.1.95075 WP_000477989.1.95077 WP_000477989.1.95090 WP_000477989.1.9510 WP_000477989.1.95120 WP_000477989.1.95174 WP_000477989.1.95210 WP_000477989.1.95304 WP_000477989.1.95318 WP_000477989.1.95327 WP_000477989.1.95342 WP_000477989.1.95361 WP_000477989.1.95372 WP_000477989.1.9538 WP_000477989.1.95409 WP_000477989.1.9544 WP_000477989.1.95452 WP_000477989.1.95476 WP_000477989.1.95500 WP_000477989.1.95537 WP_000477989.1.95545 WP_000477989.1.95550 WP_000477989.1.95581 WP_000477989.1.95603 WP_000477989.1.95639 WP_000477989.1.95681 WP_000477989.1.95699 WP_000477989.1.95704 WP_000477989.1.95713 WP_000477989.1.95714 WP_000477989.1.95737 WP_000477989.1.95760 WP_000477989.1.95781 WP_000477989.1.95806 WP_000477989.1.95877 WP_000477989.1.95885 WP_000477989.1.95914 WP_000477989.1.95918 WP_000477989.1.95947 WP_000477989.1.95954 WP_000477989.1.95983 WP_000477989.1.95986 WP_000477989.1.96014 WP_000477989.1.96022 WP_000477989.1.96030 WP_000477989.1.96056 WP_000477989.1.96057 WP_000477989.1.96067 WP_000477989.1.96075 WP_000477989.1.96133 WP_000477989.1.96135 WP_000477989.1.96148 WP_000477989.1.96165 WP_000477989.1.9617 WP_000477989.1.96221 WP_000477989.1.96228 WP_000477989.1.96255 WP_000477989.1.96280 WP_000477989.1.96283 WP_000477989.1.96301 WP_000477989.1.96314 WP_000477989.1.96322 WP_000477989.1.96334 WP_000477989.1.96362 WP_000477989.1.96433 WP_000477989.1.96472 WP_000477989.1.96495 WP_000477989.1.9650 WP_000477989.1.96509 WP_000477989.1.96535 WP_000477989.1.96538 WP_000477989.1.96550 WP_000477989.1.96554 WP_000477989.1.96566 WP_000477989.1.96591 WP_000477989.1.96603 WP_000477989.1.96628 WP_000477989.1.96634 WP_000477989.1.96654 WP_000477989.1.96663 WP_000477989.1.96678 WP_000477989.1.96699 WP_000477989.1.96705 WP_000477989.1.9675 WP_000477989.1.96780 WP_000477989.1.96836 WP_000477989.1.9684 WP_000477989.1.96854 WP_000477989.1.96855 WP_000477989.1.96856 WP_000477989.1.96859 WP_000477989.1.96882 WP_000477989.1.96922 WP_000477989.1.96928 WP_000477989.1.96965 WP_000477989.1.96969 WP_000477989.1.96970 WP_000477989.1.96985 WP_000477989.1.96997 WP_000477989.1.97000 WP_000477989.1.97014 WP_000477989.1.97019 WP_000477989.1.97029 WP_000477989.1.97034 WP_000477989.1.97077 WP_000477989.1.97139 WP_000477989.1.97141 WP_000477989.1.97151 WP_000477989.1.97161 WP_000477989.1.97164 WP_000477989.1.97205 WP_000477989.1.97206 WP_000477989.1.97228 WP_000477989.1.97230 WP_000477989.1.97234 WP_000477989.1.97241 WP_000477989.1.97256 WP_000477989.1.97276 WP_000477989.1.97293 WP_000477989.1.97311 WP_000477989.1.97336 WP_000477989.1.97348 WP_000477989.1.97352 WP_000477989.1.97355 WP_000477989.1.97367 WP_000477989.1.9737 WP_000477989.1.97392 WP_000477989.1.97399 WP_000477989.1.97427 WP_000477989.1.9743 WP_000477989.1.97444 WP_000477989.1.97450 WP_000477989.1.97456 WP_000477989.1.97466 WP_000477989.1.97468 WP_000477989.1.97494 WP_000477989.1.97530 WP_000477989.1.97531 WP_000477989.1.97537 WP_000477989.1.97576 WP_000477989.1.97585 WP_000477989.1.97664 WP_000477989.1.97687 WP_000477989.1.97688 WP_000477989.1.97696 WP_000477989.1.97699 WP_000477989.1.97706 WP_000477989.1.97729 WP_000477989.1.97744 WP_000477989.1.97746 WP_000477989.1.97762 WP_000477989.1.97776 WP_000477989.1.9788 WP_000477989.1.97898 WP_000477989.1.97935 WP_000477989.1.97955 WP_000477989.1.97967 WP_000477989.1.97974 WP_000477989.1.97997 WP_000477989.1.98008 WP_000477989.1.98054 WP_000477989.1.98058 WP_000477989.1.98073 WP_000477989.1.98077 WP_000477989.1.98131 WP_000477989.1.98161 WP_000477989.1.98174 WP_000477989.1.98179 WP_000477989.1.98191 WP_000477989.1.98195 WP_000477989.1.98233 WP_000477989.1.98248 WP_000477989.1.98249 WP_000477989.1.98281 WP_000477989.1.98295 WP_000477989.1.98307 WP_000477989.1.98328 WP_000477989.1.98352 WP_000477989.1.98353 WP_000477989.1.98359 WP_000477989.1.98360 WP_000477989.1.98366 WP_000477989.1.98372 WP_000477989.1.98387 WP_000477989.1.98394 WP_000477989.1.98409 WP_000477989.1.98415 WP_000477989.1.98425 WP_000477989.1.98497 WP_000477989.1.98501 WP_000477989.1.98506 WP_000477989.1.98533 WP_000477989.1.98585 WP_000477989.1.98586 WP_000477989.1.98609 WP_000477989.1.98659 WP_000477989.1.98667 WP_000477989.1.98703 WP_000477989.1.9872 WP_000477989.1.98723 WP_000477989.1.98730 WP_000477989.1.98734 WP_000477989.1.98741 WP_000477989.1.98750 WP_000477989.1.98786 WP_000477989.1.98797 WP_000477989.1.98821 WP_000477989.1.98825 WP_000477989.1.98842 WP_000477989.1.98865 WP_000477989.1.98880 WP_000477989.1.98883 WP_000477989.1.98894 WP_000477989.1.98924 WP_000477989.1.98978 WP_000477989.1.98985 WP_000477989.1.9903 WP_000477989.1.99090 WP_000477989.1.9910 WP_000477989.1.9912 WP_000477989.1.99136 WP_000477989.1.99195 WP_000477989.1.99217 WP_000477989.1.99237 WP_000477989.1.99262 WP_000477989.1.99308 WP_000477989.1.99311 WP_000477989.1.99394 WP_000477989.1.99414 WP_000477989.1.99418 WP_000477989.1.99509 WP_000477989.1.99523 WP_000477989.1.99525 WP_000477989.1.9965 WP_000477989.1.99683 WP_000477989.1.99688 WP_000477989.1.99700 WP_000477989.1.99768 WP_000477989.1.99777 WP_000477989.1.99830 WP_000477989.1.99849 WP_000477989.1.9985 WP_000477989.1.99859 WP_000477989.1.99884 WP_000477989.1.99901 WP_000477989.1.99934 WP_000477989.1.99950 WP_000477989.1.99954 WP_000477989.1.99955 WP_000477989.1.99963 WP_000477989.1.99984 WP_000477989.1.99999 gi|384865503|ref|YP_005750862.1| gi|385782556|ref|YP_005758727.1| gi|470193923|ref|YP_007580276.1| gi|387151448|ref|YP_005743012.1| gi|82751917|ref|YP_417658.1| gi|470195889|ref|YP_007582241.1| gi|537443532|ref|YP_008486109.1| gi|386831895|ref|YP_006238549.1| 158878.SAV2324 158879.SA2115 196620.MW2245 273036.SAB2201 282459.SAS2217 359786.SaurJH9_2349 359787.SaurJH1_2392 418127.SAHV_2308 681288.SAAV_2386 gi|269203954|ref|YP_003283223.1| gi|15925314|ref|NP_372848.1| gi|470197854|ref|YP_007584255.1| gi|49487107|ref|YP_044328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]