SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|240102993|ref|YP_002959302.1| from Thermococcus gammatolerans EJ3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240102993|ref|YP_002959302.1|
Domain Number 1 Region: 247-602
Classification Level Classification E-value
Superfamily SIS domain 2.88e-111
Family double-SIS domain 0.000000123
Further Details:      
 
Domain Number 2 Region: 2-228
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.97e-75
Family Class II glutamine amidotransferases 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|240102993|ref|YP_002959302.1|
Sequence length 602
Comment glucosamine--fructose-6-phosphate aminotransferase [Thermococcus gammatolerans EJ3]
Sequence
MCGIIGYIGDRKACEVIVRGLKRLEYRGYDSAGVVTAQGNEIEVRKGAGRIDELAQRLGF
LEMEGNRGVGHTRWATHGVPNDINAHPHTDCSGKIALVHNGIIENFAELKEELLKKGHVF
TSDTDTEVIAHLIEEELKSAENFEEALRRALKRLRGSFALGIIYADEPDRIYVVRNESPL
VIGVGNGENFAASDVPAFLEYTNRVVFLDDGEYAILKKDSYVVKRLDTGEIVEKPVHEIE
WTLEMAEKAGYPHFMLKEIYEQPRAIRDAIHGNREVIGTVAEEIANYERIIFVAMGTSYH
AALVGKYLFQRLVKRVPIVEEASEFRYEFEDLVDENTLLIAITQSGETADTLAAMRLAKR
KGAKVLAIVNVVGSMATRIADLTLYTHAGPEIGVAATKTYTTQLTVLTMLAMELARKLGT
IERDYLNRLEEDLQRVPELVERVLSHDESLRELAESLVGKRDFFYIGRGIGFPTALEGAL
KLKEISYIHAEGLSAGELKHGPLALLEEGVPVVAIAPSGKTFSKMVSNIEEAKARGALII
TLSDRKEAEKFSDVLIEMPPLDELLTPITYVVPLQLLAYHLAVLRGNDPDKPRNLAKSVT
VE
Download sequence
Identical sequences C5A5C6
WP_015858552.1.60195 593117.TGAM_0936 gi|240102993|ref|YP_002959302.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]