SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|240103520|ref|YP_002959829.1| from Thermococcus gammatolerans EJ3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|240103520|ref|YP_002959829.1|
Domain Number - Region: 171-226
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0863
Family Galactose oxidase, central domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|240103520|ref|YP_002959829.1|
Sequence length 394
Comment hypothetical protein TGAM_1463 [Thermococcus gammatolerans EJ3]
Sequence
MIPMKGKAIVLLTTILAVLGVLVIALHAHSSPSEVVAIEIRNSTGARILVKALYPDGFRE
IRPLSIEGETVYLDVSGLRRAWGEVVERRSYGGEPFIVLTVVRGGKVAVHGISLGEKARS
SKITIVPSYRRLSQVNASLGQSGGTSRTSSSDDVYEILENSEERTIPAVVAEVLNFDRNS
WGQVTWGYLQNARVGFGVYVFLNGELMKVGTIYLYSPRGGSVSHAAFGRGESVYVWMNFI
YRYERWSVHVNGGNFYEEYVFVKGFEPASLSWGHERPPNVMPAPVSSWKLAGRYTSDTIT
YPYYQFSLNELPSDYFSIDASGFVSALSSEGAIPGVWPGNFSIDVKYKSGNMSAFTFTLD
LYGERGSCHPVFEGLSKAQGKYHGVPLVAFRIGG
Download sequence
Identical sequences C5A6V3
593117.TGAM_1463 gi|240103520|ref|YP_002959829.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]