SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|240103561|ref|YP_002959870.1| from Thermococcus gammatolerans EJ3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240103561|ref|YP_002959870.1|
Domain Number 1 Region: 52-402
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 2.35e-19
Family Galactose oxidase, central domain 0.022
Further Details:      
 
Domain Number 2 Region: 683-748
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000216
Family Carboxypeptidase regulatory domain 0.052
Further Details:      
 
Weak hits

Sequence:  gi|240103561|ref|YP_002959870.1|
Domain Number - Region: 561-598
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000196
Family Rhamnogalacturonase B, RhgB, middle domain 0.012
Further Details:      
 
Domain Number - Region: 473-530
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0053
Family Rhamnogalacturonase B, RhgB, middle domain 0.043
Further Details:      
 
Domain Number - Region: 751-808
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00942
Family Carboxypeptidase regulatory domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|240103561|ref|YP_002959870.1|
Sequence length 873
Comment hypothetical protein TGAM_1504 [Thermococcus gammatolerans EJ3]
Sequence
MKVGLRLAQLIGGKRMKRLIAVVWIALLLGFLVVTLKMAKAEDAKWWAKTYRGKAYAIAV
APNGDVIVTGYTYSFGAGKSDVWVLRLEKNGNVKWQKTYGGSDLDKATAVAVALNGDIII
AGSTESFGAGRRDIWVLRLDGEGDVKWQKTYGGRIYDDAHAVAVAPNGDIIVLGSTESFG
APYHSDVWILRLDANGNVKWQKTYGGSDYDWAYAVAIAPNGDIIAAGGTERFAAGIVDVW
ILRLDENGNVKWQKTYGGNSYDKATAVAVVENEDIIVAGYYGATDFQGAGADVWILRLDE
NGNVKWQTTYGGHYRDNAYAIAVTPNEDLIVAGCTESFGTGNYDAWILRLDSKGNVKWQK
TYGGSDDDSAHRVVVAPNGDIIVLGSTESFGTGYYDTWILRLPSDGNLPKCDFCGDSNAK
ISVPDIKVGNFSVTIMNTNATVQTTNVYPHSSEDIGVETQYISVGTISVTTNPSGAKVYV
NGTYIGATPLTTNLSVGTYEITLKMKNYKNYTTTVAINPNEEVELNVILTPLPAHLTLNS
TPSGVEIYVNGTYRGETPVTLKLSPGTYTVKFIKDEYENYTMSVTLSAGEAKNISVTLNL
AYGYLSIESSPSKAEVYVDDNYIGKTPIDQYKLSTGVHEVKVEKSNYNSLTKMVTLNSSE
KTKLNVILTPLPAHLMVNSNPSGAVVYINGTYKGKTPLTSELEPNTYNLRVSKEGYANYT
TTVIINPGENKTINVELEPMIAHIEVSSDPAGAKVYVNGTYKGTTPLTLELGSGSYKVRA
TKEGYEDYVITVELKAGESKEITAQLKEKSTTTTTTTTVATSTSAGETTTTATSNGSGTT
KTTSPKEGGGICGPALVIALALVPILHRKRKHR
Download sequence
Identical sequences C5A6Z4
gi|240103561|ref|YP_002959870.1| WP_015859117.1.60195 593117.TGAM_1504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]