SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|240103948|ref|YP_002960257.1| from Thermococcus gammatolerans EJ3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240103948|ref|YP_002960257.1|
Domain Number 1 Region: 2-213
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.17e-45
Family Decarboxylase 0.0029
Further Details:      
 
Domain Number 2 Region: 215-404
Classification Level Classification E-value
Superfamily SIS domain 1.96e-39
Family mono-SIS domain 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|240103948|ref|YP_002960257.1|
Sequence length 406
Comment bifunctional 3-hexulose-6-phosphate synthase/6-phospho 3-hexuloisomerase [Thermococcus gammatolerans EJ3]
Sequence
MILQVALDVTDIDQALSIAEKAARGGAHWLEVGTPLIKKEGMRAVELLKRRFPDRKIVAD
LKTMDTGALEVEMAARHGADVVSILGVADDKTIKDAVDVARRYGIRVMVDLIGVKDKVKR
AKELEKMGVHYILVHTGIDEQMQGKSPLEDLEKVVKAVNVPVAVAGGLNLETIPKVIELG
ATIIIVGSAITKAKDPEKVTRQIIDLFWGEYMMTIKKAMLDILDHIKGVAESLKLEQVRG
FVDAMIGANKIFIYGAGRSGLVGKAFAMRLMHLDFNVYVVGETITPAFEPGDLLIAISGS
GETQSIVDAARIAKEQGGKIAAITSYANSTLGKLADVVVEIPGRAKTDVPTDYIARQMLT
QYKWIAPMGTLFEDSTMIFLDGIIALLMATFQKTEKDMKRKHATLE
Download sequence
Identical sequences C5A1X4
gi|240103948|ref|YP_002960257.1| 593117.TGAM_1891 WP_015859500.1.60195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]