SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254295380|ref|YP_003061403.1| from Hirschia baltica ATCC 49814

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254295380|ref|YP_003061403.1|
Domain Number 1 Region: 394-491
Classification Level Classification E-value
Superfamily TrpR-like 7.06e-31
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.00024
Further Details:      
 
Domain Number 2 Region: 157-369
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.65e-28
Family Extended AAA-ATPase domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|254295380|ref|YP_003061403.1|
Sequence length 500
Comment chromosomal replication initiator protein DnaA [Hirschia baltica ATCC 49814]
Sequence
MDNQTHKESMSLFGDLDMQAEILSEGGRGPVIWSEVRAKLRDLYGASSFDKWMASLVFVA
EVDGTVTLSTESRIDRERIDRDYMRNITGVWAALDPKSRPVNLMADADLCEDLKALAKTN
RANQNKKAVSVKASAENTKVADKKESVDFTQGVDLTQTFDTLVVGDSNQLAANIARKVAS
GIVGPVSVVLFYGAHGVGKTHLLRAIEHDCAVQTKAKSAVYMSAEDFMLSFVEGVRQKDT
SAQRNRIRNADIVLLDDLQLITSRAATLKEFFQHLRAVTSNGGKVVLSADAAPTRLECLD
DRMRDDIQGGVVVEVHRPEIEMRAEIIRSKIAIIKEDFPEFSLEDAWIDMMAERLTASGR
ALYGAVRNVFAGTVLANKPVTEAAVENAIRLIVGERRAPKIDTIKDVVAKYYGVTKADLD
SASRRRNLAQPRQIAMYFCRELTTCSYPLIGFNFGKRDHTTVIYACRKVQERIDLESELG
DEIVKLQRQIMDDPRNQQFN
Download sequence
Identical sequences C6XRU6
WP_015828856.1.52863 582402.Hbal_3038 gi|254295380|ref|YP_003061403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]