SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254295534|ref|YP_003061556.1| from Hirschia baltica ATCC 49814

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254295534|ref|YP_003061556.1|
Domain Number 1 Region: 20-288
Classification Level Classification E-value
Superfamily SIS domain 1.22e-52
Family mono-SIS domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|254295534|ref|YP_003061556.1|
Sequence length 324
Comment KpsF/GutQ family protein [Hirschia baltica ATCC 49814]
Sequence
MDYLASARDVINCEIKGLEALVQALNVDSSAVISEAFPRAIKLMQNVEGRIIVSGMGKSG
HIANKIAATLASTGAPSSFVHPGEASHGDLGMISQKDIVLAISNSGETKELADIIAYTRR
FKIPLIAITSGANSSLAKACDCLLLLPPAAEACGQTRAPTTSTTMTLAIGDALAVTLLTE
KGFGETDFKVYHPGGKLGAAFRRVSDLVRDHANLPLVQSGSIAGDAVPIISQGGFGCVGV
INSAGDLEGMITDGDLRRHFGKNFSTVIVDDIMTKSPLTITNDMLAARALELISSNRITA
LFVLEDKKPIGILHVHDCLSDGVI
Download sequence
Identical sequences C6XS18
WP_012778246.1.52863 582402.Hbal_3192 gi|254295534|ref|YP_003061556.1|NC_012983 gi|254295534|ref|YP_003061556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]