SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227830154|ref|YP_002831933.1| from Sulfolobus islandicus L.S.2.15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227830154|ref|YP_002831933.1|
Domain Number 1 Region: 1-179
Classification Level Classification E-value
Superfamily LigT-like 3.66e-40
Family 2'-5' RNA ligase LigT 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|227830154|ref|YP_002831933.1|
Sequence length 194
Comment 2'-5' RNA ligase [Sulfolobus islandicus L.S.2.15]
Sequence
MRLFIGIEVPQSPKLLEIFEIVKNTGADIKLVEPYNIHITLLFLGEVRDDRVEEVKDSMS
GLKFNKFKVTLKGLGAFPNLTRPRVVWVGIVEGQQQLRQIRSYILNELLKRKIRPEDDKD
FSPHLTIGRVKSYNSISNLINTINENMNVDIGTFEVNNVVLFKSTLTPKGPIYDKLFEVS
SIDRGGSTEDNKTH
Download sequence
Identical sequences C3MPH5 C3MYG3 C3N557 C4KGR0 D2PJL5 F0NGV6 F0NK98 M9U6B5
gi|479325464|ref|YP_007865519.1| gi|229584676|ref|YP_002843177.1| gi|385775768|ref|YP_005648336.1| gi|227827461|ref|YP_002829240.1| gi|227830154|ref|YP_002831933.1| gi|284997571|ref|YP_003419338.1| WP_012711202.1.100559 WP_012711202.1.27011 WP_012711202.1.27461 WP_012711202.1.34992 WP_012711202.1.44962 WP_012711202.1.47130 WP_012711202.1.48461 WP_012711202.1.60638 WP_012711202.1.66823 WP_012711202.1.67233 WP_012711202.1.68242 WP_012711202.1.74483 WP_012711202.1.83431 WP_012711202.1.84481 WP_012711202.1.89621 WP_012711202.1.90709 WP_012711202.1.91160 WP_012711202.1.97021 426118.M164_1170 427317.M1425_1181 427318.M1627_1245 429572.LS215_1278 gi|385773138|ref|YP_005645704.1| gi|238619617|ref|YP_002914442.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]