SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227831306|ref|YP_002833086.1| from Sulfolobus islandicus L.S.2.15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227831306|ref|YP_002833086.1|
Domain Number 1 Region: 2-199
Classification Level Classification E-value
Superfamily SGNH hydrolase 4.79e-38
Family TAP-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|227831306|ref|YP_002833086.1|
Sequence length 201
Comment G-D-S-L family lipolytic protein [Sulfolobus islandicus L.S.2.15]
Sequence
MFAGDSITDREKSNNAPLGYGYVNLFYNLMLAKHPETKITVINSGISGNTVIDLIDRWDD
DVLSYKPNWISILIGINDLHKFLGGLTTFNPENYYENLRRLLKYTRKVLNNVNFILMTPF
YISRNKLEGGFRAKVLGLLPQYIEKVRLLSNEFSATYIDLHDTFKKLVNIREPNVYAPEP
VHPNFTGHMVIALKLLEALEI
Download sequence
Identical sequences C3ML39
WP_012714340.1.66823 429572.LS215_2478 gi|227831306|ref|YP_002833086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]