SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227829433|ref|YP_002831212.1| from Sulfolobus islandicus L.S.2.15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227829433|ref|YP_002831212.1|
Domain Number 1 Region: 633-710,800-1008
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.99e-68
Family Tail specific protease, catalytic domain 0.0000000631
Further Details:      
 
Domain Number 2 Region: 3-263
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 8.5e-34
Family Tricorn protease N-terminal domain 0.00000253
Further Details:      
 
Domain Number 3 Region: 197-468
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 1.26e-24
Family DPP6 N-terminal domain-like 0.023
Further Details:      
 
Domain Number 4 Region: 713-799
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000313
Family Tail specific protease PDZ domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|227829433|ref|YP_002831212.1|
Sequence length 1008
Comment peptidase S41 [Sulfolobus islandicus L.S.2.15]
Sequence
MKAYYMYPDIRGDLISFTSDDDVWLLSLKDMKPLRITSGLGVSIRPKISPSGRKVAFTVV
WLKSGKQGGDIYVVEDGQARRVTYFGSRNSRVANWLSEDEIIVITDFHTPFGQWNEAYKV
DVNNGETEKLPFGMLSNIVKRDNVIVIVRGYQDLPNWKGYKGGTKGELWISRDGGKTFEK
FVSLDGNASWPMIVKERVYFLSNHEGVGNLYSVDLNGKDLRRHTNFTDFYCRNANSDGKR
IVFQNAGDIYLYDPEKDSLSKLDIDLPTDRKKRQPKFVSVIEYMNEAVVNGNYIALTSRG
KAFLMRPWDGPAVQLGKKQGVKYRQIQALPNGDVIGVNDDDKLVILGKDGNEKVINRDFA
RIERVKVSPDGKKILLSNNKLELWVYEIDSDNARLIDKSEYDLILEFDWHPNGEWFAYAF
PEGYYTQSIKLARIDGKIVRITTPYGYDFSPSFDPDGRYLYFLAARHLDPTNDKVIFNLS
FQRVVKPYLVVLGNYYSPFNQPLDESSSNDKNVVIEGIEDRVIPFPIEEENYVQIAGAKN
NKIFLFSYPIRGLRTQTGDVFGRLEVYDLENKAKELYADNVSSFSLSSDKSKILLMLKDN
LRLFDVNAKPDFNSAGRKGGVIDLSRVKVYVEPEKEWRQMLKETWKLMKQNYWNEERLKN
WDSVLPKYERLLDRVSTRFELSDIIQEMQGETRTSHSYETAYDYDTPEPLSVGGLGGEFE
YNENNKCYKITKIYVGDSTNENERSPLRDPGVQLNVGDCIKAIDGEEANGNIYSHLVNKD
QVILDVITNDGKNKRVTVKVLKDERFLIYRYWVEKNREYVHEKSKGRLGYIHIPDMMYQG
FAEFYRLFMSEFHREGLVVDVRFNRGGFISGLLLEKLLLKRVGYVHPRNGKPIPMPYFSS
PKVLVGITNEHAGSDGDIFSFLFKKYKLGVLIGRRTWGGVVGIRPRYRLVDKTYISQPEF
AVNFEDVGFGIENYGVDPDIVVEIKPEDYASNSDTQLDTAIELALKQL
Download sequence
Identical sequences C3MLG9
gi|227829433|ref|YP_002831212.1| 429572.LS215_0440 WP_012712991.1.66823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]