SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256419913|ref|YP_003120566.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256419913|ref|YP_003120566.1|
Domain Number 1 Region: 4-311
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.92e-83
Family Methylenetetrahydrofolate reductase 0.00000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256419913|ref|YP_003120566.1|
Sequence length 317
Comment methylenetetrahydrofolate reductase [Chitinophaga pinensis DSM 2588]
Sequence
MKVTEHIAQAKDTLISFEILPPLKGKSIDSIYDHLDPLMEFKPAFVNVTYHRSEHMFKKR
ADGSFEKVEIRKRPGTVAICAALMGHYNVDAVPHLICGGFSREETENALIDLNYLGVDNV
LVLRGDAPKNETFFEPEPNGHRYADQLLQQVVHMNNGIYLEEDLQSGVKTKFCIGVAGYP
EKHFEAPNMQTDMSYLKKKVENGADYIVTQMFFDNQKFIDFVGKCREAGITVPIIPGLKP
ITTRKQLTILPRTFHVDIPTELSTEILKCKTDKEVEEVGTEWLIKQSKELKQFGVPVLHY
YTLGKPHVIHKAVAQVV
Download sequence
Identical sequences C7PK24
gi|256419913|ref|YP_003120566.1| WP_012788541.1.2976 485918.Cpin_0867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]