SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256419924|ref|YP_003120577.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256419924|ref|YP_003120577.1|
Domain Number 1 Region: 72-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.8e-43
Family RecA protein-like (ATPase-domain) 0.029
Further Details:      
 
Domain Number 2 Region: 255-269,303-456
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.33e-39
Family ATP-dependent protease Lon (La), catalytic domain 0.002
Further Details:      
 
Weak hits

Sequence:  gi|256419924|ref|YP_003120577.1|
Domain Number - Region: 5-32
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0345
Family Rubredoxin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256419924|ref|YP_003120577.1|
Sequence length 457
Comment DNA repair protein RadA [Chitinophaga pinensis DSM 2588]
Sequence
MKIKTAFFCQNCGYESAKWTGKCPSCGQWNTFVEEKVQKDIPLRNAGWQPEKEHGAKSDN
IVNLSEISGTEEERLLTPDAELNRVLGGGIVPGSLVLVGGEPGIGKSTLFLQNALLLKDI
TTLYISGEESAQQIKMRADRLQVKNDLFYLLTETSTQTIFQEIKKLRPQLVIVDSIQTLQ
SPFIESAPGSVSQIRETTAELQRFAKESHTPVFLIGHITKDGSIAGPKILEHMVDTVLQF
EGDQHYAYRILRTIKNRFGSTAELGIYEMTGGGLRQVTNPSEILISQREDQLSGVAIAAT
IEGMRPMLVEVQALVTQSVYGTPQRTATGFDLRRLQLLLAVLEKRGGFHFGVKDVFLNIA
GGIRVEDPSIDLAVLCALLSSYEDIPISSKICFAGEVGLSGEIRAVNRIEQRVAEAEKLG
FEKIFISRYNKKGTDISKFNIEVIPVGRVDEVYRGLF
Download sequence
Identical sequences C7PK35
WP_012788552.1.2976 485918.Cpin_0878 gi|256419924|ref|YP_003120577.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]