SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256421418|ref|YP_003122071.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256421418|ref|YP_003122071.1|
Domain Number 1 Region: 429-483
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0000000000000507
Family Rubredoxin 0.0027
Further Details:      
 
Weak hits

Sequence:  gi|256421418|ref|YP_003122071.1|
Domain Number - Region: 7-47
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.00442
Family Duplicated SiR/NiR-like domains 1 and 3 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256421418|ref|YP_003122071.1|
Sequence length 493
Comment rubredoxin-type Fe(Cys)4 protein [Chitinophaga pinensis DSM 2588]
Sequence
MSRYTQTVSINFTGGIISPGQLLTILDIAEASRVTQVRFGLRQQLLMEVQGKYVEQFEAD
CAREQVSWHSYGTAPNITSSYPGAGIFINEGWLTEGIYKDVFSLFDYTPTLKINICDNKQ
TFTPFFSGHINWIAAGAAHYWHLFIRFPKSSRLFAWPDLIYTNNIAQLSQCIESVLAATP
DISNEALYTAVKGQLEYNSKPVTTELELPAFHLPYYEGFNRHENHYWLGIYRRDEEFPVA
FLRNLCNICLETKTGQLYATSWKSLIIKNIAPEHRRLWDYILGKYGINVRHAANELNWHV
EDDSEDALIIKRHIIRHFDNADVRTYGLCFSIRINPGNNCFGSIVISKQEDKYKSRLKGH
HRYDILYTQDFNPNSGTLLPYRTGVAKEHLGPYITSLCREFYDNSAPTDPLLSYVAGQQT
VTAIAHTEKAVHQCTRCLTVYDETIGDPDQGIAPGTAFPVLPATYHCSLCDAPRESFTTV
PATSLGWLAGTQD
Download sequence
Identical sequences C7PGD8
WP_012790046.1.2976 485918.Cpin_2379 gi|256421418|ref|YP_003122071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]