SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256421423|ref|YP_003122076.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256421423|ref|YP_003122076.1|
Domain Number 1 Region: 627-801
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.81e-46
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 100-297
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.53e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0059
Further Details:      
 
Domain Number 3 Region: 497-635
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.1e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.012
Further Details:      
 
Domain Number 4 Region: 19-125
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000233
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256421423|ref|YP_003122076.1|
Sequence length 830
Comment nitrite reductase (NAD(P)H) large subunit [Chitinophaga pinensis DSM 2588]
Sequence
MVSYKFCEKIISRIPAGTAEIVVFGEEPRPAYDRVHLSEFFAGKTADDLLMAPADWYAAN
DITLHLGDPVQQIDRSNKTVHSYKGITEAYDYLIIATGSSAFVPPIPGVDKKGVFIYRTI
EDLELMRDYAPRAKRGVVIGGGLLGLEAAKAMLDLGITDTHVIEFAPRLMPRQIDESGSR
ILEQQLNQLGLVIHTNKNTSEVLGGDTITGLQFADETHLAADMLVISAGIKPRDELAKLS
GLETGHRGGILVNEYMQTTDPEIYAIGECALYNGMIYGLVAPGYEMAEVVATHIYNSLAA
APVPEKTFTGFDMSTKLKLIGVDVASFGDPFAPADTCRSIVFEDTMKGVYKRISITNDGK
HLLGGILIGDADAYNMLLQTAKNKVILPPNPEDVLLGARGGSQETGAGVLGLPDDAIICS
CESITKGDICTAVEAGNETLDAIKKCTKAATCCGGCTPMVKDLITGTMKAQGKYIRNVIC
EHFAYSRQELYDLIRIKNIRAFDEALDHYGAGDGCEVCKPVVASIMASLWNDMILDKGND
TVQDSNDRFLANIQKGGTYSVVPRIPGGEITPAKLLVIAQVALKYNLYTKITGGQRIDLF
GAHLDDLPNIWEELIDAGFESGHAYGKALRTVKSCVGSTWCRFGLHDSVTFAIQIEERYR
GLRAPHKLKSAVSGCIRECAEAQSKDFGIIATEKGWNLYVCGNGGSKPQHAILLASDLDS
ATCIRYIDRFLMFYIKTADPLTRTATWLNKLDGGISYLRNVVVNDSLGIAAELEAEMQGL
VDRYKCEWREVVESPELRKRFSHFVNAPGTKDPTVKFDNLREQKKAAEWK
Download sequence
Identical sequences C7PGE3
gi|256421423|ref|YP_003122076.1| 485918.Cpin_2384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]