SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256422369|ref|YP_003123022.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256422369|ref|YP_003123022.1|
Domain Number 1 Region: 2-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.73e-42
Family ABC transporter ATPase domain-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256422369|ref|YP_003123022.1|
Sequence length 254
Comment FeS assembly ATPase SufC [Chitinophaga pinensis DSM 2588]
Sequence
MLTIKNLHAEVDGKKILKGINLEIRKGEMHAIMGPNGSGKSSLSSVLAGRENYTVTEGEV
IFEGKNLLDLSPEDRAREGLFLAFQYPVEIPGVSNLHFLKTALNEIRTYHNLPPLESKEF
LKLTKEKQQLVDFNANLMNRSLNEGFSGGEKKRNEVFQLAMLDPKLAILDETDSGLDIDA
LRIVAAGVNKLRSADKAFMVITHYQRLLEYIVPDFVHVLYNGQIVKTGTKELALELEEKG
YDWLKEEVHQKESV
Download sequence
Identical sequences C7PS27
gi|256422369|ref|YP_003123022.1| 485918.Cpin_3354 WP_012790997.1.2976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]