SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256422469|ref|YP_003123122.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256422469|ref|YP_003123122.1|
Domain Number 1 Region: 99-196,271-320
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.00000000392
Family Terpene synthases 0.039
Further Details:      
 
Weak hits

Sequence:  gi|256422469|ref|YP_003123122.1|
Domain Number - Region: 16-117
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 0.000638
Family Class I alpha-1;2-mannosidase, catalytic domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256422469|ref|YP_003123122.1|
Sequence length 632
Comment hypothetical protein Cpin_3454 [Chitinophaga pinensis DSM 2588]
Sequence
MNNASRRHFIKQSAAGLLGALYTTQGLPLPAFAQHELQPLCQELVRTWGQRLLSLQITDK
NDHNYGTLIYPPENIIHGRMGDCIYPFLHLAATTQDHRYADAAALLYRWMERTVSQEDGS
WLNEPKQGAWKGTTVFSAIALAEALKHHGALLDAPLKQEMLARLKKSGDFIYTNFTIDYG
NINYPITATYALSLLGELLDEKRFTERGRLLARKALSFITPKDKLLSGEGGPYYSKSPKG
CLSVDLGYNVEESLPSLVLYAKLTNDDTVLQAVQGLLSAHLAFMLPDGGWDNSWGTRNYK
WTYWGSRTSDGCQPAYALMADSVPEFYKAAVVNTQLLQSCTHDGLLHGGPHYFSHNAPVS
LHHTFCHIKALVTVLDHGIPTPPRTFAKVTLPREQAYGSKYFEDIQTGLIAVGKFRGTVT
AYDRDYKDFKGGHASGGALSMLWQEKAGVILAASMNEYQLYEAGNMQQDTDPLSVCLTPR
IELKEAGNTYMNIQDFGARMAIEDNDGEVIVQTSASLVDKDQQAPASGDITCTTTWRFSK
DRITLRFKHTGTEQQGIRIIIPLISAATEDFRVIKPELAEIAKMDCVVRLKADKPLNVLP
MTGKRVFNYVPGLEAIPFYSTASELEVVITVG
Download sequence
Identical sequences C7PTD1
485918.Cpin_3454 gi|256422469|ref|YP_003123122.1| WP_012791097.1.2976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]