SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256424581|ref|YP_003125234.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256424581|ref|YP_003125234.1|
Domain Number 1 Region: 24-441
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 3.01e-104
Family Class I alpha-1;2-mannosidase, catalytic domain 0.00000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256424581|ref|YP_003125234.1|
Sequence length 457
Comment mannosyl-oligosaccharide 1,2-alpha-mannosidase [Chitinophaga pinensis DSM 2588]
Sequence
MKKCIVAAAAMIAYLPMKAQQAELSLSVKQEFIRSWDAYKRYAWGHDVLLPQTKTYTDWY
EQPIRISQIDAYSTMKVMGLQKQARDIEKFVTDSCNFDIDVYVKTFDVNNRVLGGLLYMY
SCTHQPKILERARDFGDRLLKAFRSPTGIPYYWVNLKTGKVKGEKVNTAEAAAYTLEMGI
LSYYTKDPKYYQAARKATEAIYGRRSALNLTGNIINNETGDWLETISCIGAGGSAYYESM
LKTWLLFKDEALKEMWEKTITAVHQYNAEESDTAIWYRRTDMYSGETKNTTATGYDAFLP
ALLCIDNDAEQAARVHRTWNNLWKQYGMIPMIYDFRRQHITAAAYDLNPEIIESAWYLYD
YTKDTAYQQMGRQYYSDILQYCRAGAAFTGVMDIRSKQQQNKMPVYFFATTMKYLYLLFT
PDSGLNTLDYVFTAEGNPFKTDEFKAAETARRLGINQ
Download sequence
Identical sequences C7PAR9
WP_012793200.1.2976 gi|256424581|ref|YP_003125234.1| 485918.Cpin_5607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]