SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256424911|ref|YP_003125564.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256424911|ref|YP_003125564.1|
Domain Number 1 Region: 42-104
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000419
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|256424911|ref|YP_003125564.1|
Domain Number - Region: 182-223
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00785
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256424911|ref|YP_003125564.1|
Sequence length 273
Comment protein PASTA domain-containing protein [Chitinophaga pinensis DSM 2588]
Sequence
MFNSITKRSFGFNLLVIIGIFAVLGLLFFSLLGIITKHGDTLTVPDVYKKNIQEATMILE
KEGFSVDVRDSIYVDSLPGLAVWEQTPARGSVVKVGRTIYLTVNKVIPPMVQMPDLTGLT
FRSAEMTLHSLRLNVGDTIYKPDFATNTVLQQLLNGKTVKPGRDIPEGSNITLVLSSGTG
NTENPVPDLTGMTYLEAKETLSASNLGLGTVIIDPSVTDTANAFVVKQIPLRKNPLNETN
MIRAGESIDIWLSNTRPEKDSGVAPPAPADEQH
Download sequence
Identical sequences C7PEF4
485918.Cpin_5945 gi|256424911|ref|YP_003125564.1| WP_012793529.1.2976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]