SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256425407|ref|YP_003126060.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256425407|ref|YP_003126060.1|
Domain Number 1 Region: 72-390
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.51e-87
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256425407|ref|YP_003126060.1|
Sequence length 392
Comment proline dehydrogenase [Chitinophaga pinensis DSM 2588]
Sequence
MEKQLSLSFENTAIAFESKTDKALKKADFLFTNIGKPWLVKVGAAVTPFALKIGLPIKGL
IRSTIFSQFCGGENLQEAAATASSLGKFHVGVALDYGVEAMEGEENYDHAVPEFVRAIEY
AAGNPNIPFIAIKVTGFARFSLLEKLHANETLTPEEAAEYARVRQRIQTIAATAAKHKVG
LLIDAEESWIQQPVDDLTEELMAQFNTTNAIVYNTFQMYRHDRLAFLKRSFEKAQQQGYL
LGAKLVRGAYMEKERKRAEEMGYPSPIQPDKEATDRDYNAAVTFCMERLDKLAVFVGTHN
EQSSMLAASLLHQQELPHNHPHVSFSQLLGMSDNITFNLAHAGYHVSKYLPYGPVKDVMP
YLLRRAQENTSISGQVGRELGLIRKERKRRGI
Download sequence
Identical sequences C7PKU9
gi|256425407|ref|YP_003126060.1| 485918.Cpin_6455 WP_012794023.1.2976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]