SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256425531|ref|YP_003126184.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256425531|ref|YP_003126184.1|
Domain Number 1 Region: 8-273
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.85e-25
Family Methylenetetrahydrofolate reductase 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256425531|ref|YP_003126184.1|
Sequence length 331
Comment hypothetical protein Cpin_6579 [Chitinophaga pinensis DSM 2588]
Sequence
MGHTLADKIKSGHSRLVFYSLTPPKITTNQDRIAEIAQAQAERISALDIDALILYDIQDE
TTRTEQERTFAFIPTVLPEQYSRDYFHQLKVPRIIYKSIANLNDAQFKQWLTDNGDIQHS
VFVGASSQQQIEQTNFSLSDAYALRQQHAPELLIGGVTIPERHAKKGDEHVRLSNKMEQG
CSFFVSQCVYNVNDTKDVLADYYYHSREISQTPAPIVFTLAPCGSLKTLQFMEWLGIKVP
KWLYNDLKHSKDILQASIDTCLHVASELLEYADKKNMSIGFNIESISIKKDEISASIDLL
DQVLKLSKQSLKMAPERASGKVVEAVRMPHY
Download sequence
Identical sequences C7PM78
gi|256425531|ref|YP_003126184.1| 485918.Cpin_6579 WP_012794146.1.2976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]